Recombinant Saccharum hybrid Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Saccharum hybrid Photosystem II D2 protein (psbD) is a chloroplast-encoded subunit critical for the structural integrity and function of Photosystem II (PSII), the enzyme responsible for water splitting and oxygen evolution in photosynthesis. Produced via heterologous expression in E. coli, this protein enables mechanistic studies of PSII assembly, repair, and evolutionary adaptations in sugarcane (Saccharum hybrid), a key bioenergy crop.

Post-Translational Modifications

  • C-Terminal Processing: The precursor D2 (pD2) undergoes cleavage by CtpA peptidase to achieve its mature form, a step essential for PSII activity .

  • Redox Regulation: Proteins like RBD1 (rubredoxin 1) stabilize PSII assembly intermediates via disulfide-bond management, with knockouts causing severe PSII defects .

Production Workflow

  • Gene Source: The psbD gene (locus PS090) is cloned from sugarcane chloroplast DNA .

  • Expression: Optimized codon usage in E. coli ensures high-yield production (~1–5 mg/L culture) .

  • Purification: Immobilized metal affinity chromatography (IMAC) exploits the His tag, achieving >90% purity .

Research Applications

ApplicationUtility
Structural StudiesCryo-EM and X-ray crystallography of PSII complexes .
MutagenesisInvestigating D2’s role in photodamage repair and oxidative stress responses .
BiotechnologicalEngineering stress-tolerant sugarcane varieties with enhanced PSII efficiency .

Comparative Analysis Across Species

FeatureSaccharum hybrid (Plant)Synechocystis (Cyanobacterium)Chlamydomonas (Alga)
Rate-Limiting RoleNot primary Yes Yes
mRNA RegulationTranscript abundance critical Post-transcriptional Nac2/RBP40-dependent stabilization
C-Terminal ProcessingCtpA-mediated CtpA-mediated CtpA homologs

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade the recombinant protein; glycerol stabilization is recommended .

  • Functional Studies: Further research is needed to map D2’s interactions with auxiliary assembly factors (e.g., Ycf48, Psb34) in plants .

  • Agricultural Impact: Leveraging psbD transgenics to enhance sugarcane’s photosynthetic efficiency under abiotic stress .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbD; PS090; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Saccharum hybrid (Sugarcane)
Target Names
psbD
Target Protein Sequence
MTIAVGRVTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAISFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, producing O2 and a proton gradient subsequently used for ATP generation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors. D2 is crucial for the assembly of a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem II D2 protein and what is its fundamental role in photosynthetic organisms?

The Photosystem II D2 protein, encoded by the psbD gene, is a core component of the photosystem II (PSII) reaction center complex essential for photosynthesis. In Saccharum hybrids (sugarcane), as in other photosynthetic organisms, D2 functions as a critical structural and functional protein within PSII. Research has demonstrated that D2 accumulation represents a key regulatory step for PSII reaction center assembly . The protein contains 353 amino acids in its full-length form and features multiple transmembrane domains that anchor it within the thylakoid membrane . Functionally, D2 works in concert with the D1 protein to coordinate cofactors involved in the primary photochemical reactions of photosynthesis, facilitating the water-splitting process and electron transport chain initiation.

How does the psbD gene structure in Saccharum hybrids compare to other plant species?

The psbD gene in Saccharum hybrids exists within the complex genomic background of modern sugarcane, which represents polyploid interspecific hybrids combining genetic material from Saccharum officinarum and Saccharum spontaneum . Unlike simpler plant genomes, the allopolyploid nature of sugarcane creates multiple allelic variants of the psbD gene. The complete amino acid sequence of the Saccharum hybrid D2 protein (353 amino acids) shows conserved functional domains typical of D2 proteins across plant species . Researchers investigating psbD in Saccharum must consider this genomic complexity when designing experiments, as allelic variation can influence expression patterns and protein function. Comparative genomic approaches using the sequenced haploid S. spontaneum (AP85-441) genome as a reference can help identify psbD variants across the eight homologous chromosome groups .

What expression systems are most effective for producing recombinant Saccharum psbD protein?

E. coli has been successfully employed as an expression system for producing recombinant full-length Saccharum hybrid Photosystem II D2 protein . When expressing membrane proteins like D2, researchers should consider several methodological approaches:

  • Codon optimization of the psbD gene sequence for prokaryotic expression

  • Use of specialized E. coli strains designed for membrane protein expression

  • Incorporation of purification tags (such as N-terminal His-tags) to facilitate downstream processing

  • Expression under controlled temperature and induction conditions to prevent inclusion body formation

For functional studies, researchers should validate that the recombinant protein maintains its structural integrity using techniques such as circular dichroism or limited proteolysis. The expressed protein can be obtained in lyophilized powder form with greater than 90% purity as determined by SDS-PAGE .

How can researchers effectively analyze D2 protein accumulation and its impact on PSII assembly in Saccharum hybrids?

To investigate D2 protein accumulation and its impact on PSII assembly in Saccharum hybrids, researchers should employ a multi-faceted approach:

  • Two-dimensional Blue-native/SDS-PAGE: This technique has proven effective for analyzing PSII reaction center core complex assembly, allowing visualization of both monomeric and dimeric forms .

  • In vivo pulse-chase radiolabeling: This method enables tracking of newly synthesized PSII components and their assembly into complexes over time .

  • Mutational analysis: Creating knock-down or knock-out constructs targeting psbD expression can reveal the regulatory role of D2 in PSII assembly. Research in cyanobacteria has demonstrated that without D2, other PSII components (D1, CP47, and cytochrome b559) fail to form mutual complexes .

  • Protein quantification: Western blotting with antibodies specific to D2 and other PSII components allows for quantitative assessment of protein accumulation under various conditions.

Data interpretation should consider that D2 accumulation represents a prerequisite for D1 accumulation and subsequent PSII reaction center assembly, as demonstrated in model systems . Researchers should also analyze upstream factors affecting D2 expression, such as the psbEFLJ operon, which has been shown to be essential for D2 accumulation in some photosynthetic organisms .

What molecular breeding approaches can be used to manipulate psbD expression in Saccharum hybrids?

Researchers interested in manipulating psbD expression in Saccharum hybrids can implement several molecular breeding strategies:

  • Interspecific hybridization: Combining S. spontaneum (as maternal parent) with elite sugarcane clones through controlled cross-pollination can generate hybrids with altered psbD regulation. Hot-water emasculation (45°C for 10 minutes) of maternal inflorescences minimizes self-fertilization during this process .

  • Marker-assisted selection: Employing molecular markers like RAPD (randomly amplified polymorphic DNA) or microsatellite markers helps identify and verify true F1 hybrids carrying desired psbD alleles .

  • Cytoplasmic manipulation: Since the psbD gene can be located in both nuclear and chloroplast genomes, creating hybrids with specific cytoplasm (e.g., S. spontaneum cytoplasm) may alter psbD expression patterns. This approach has been successfully demonstrated in developing Saccharum hybrids with S. spontaneum cytoplasm .

  • CRISPR-Cas9 genome editing: For precise modification of psbD alleles or their regulatory elements, CRISPR-Cas9 techniques adapted for polyploid sugarcane can be employed, though researchers must navigate the regulatory requirements for recombinant DNA research .

When implementing these approaches, researchers should evaluate phenotypic traits alongside molecular markers to ensure the selection of lines with improved photosynthetic efficiency and other desirable characteristics .

What are the regulatory considerations for research involving recombinant psbD in Saccharum hybrids?

Research involving recombinant psbD in Saccharum hybrids must adhere to institutional and national regulatory frameworks governing recombinant DNA work. Key regulatory considerations include:

  • NIH Guidelines compliance: Institutions receiving NIH funding must comply with the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. Individual investigators are responsible for ensuring laboratory compliance .

  • Institutional Biosafety Committee (IBC) approval: Depending on the nature of the experiments, researchers may need to register their work with the IBC before initiation. Experiments involving the cloning of genes from Risk Group 2, 3, or 4 agents into non-pathogenic prokaryotic or lower eukaryotic host-vector systems require IBC approval prior to initiation .

  • Risk assessment: Researchers should evaluate potential risks associated with creating novel recombinant constructs, particularly if they might confer altered fitness or resistance traits.

  • Containment requirements: Appropriate physical and biological containment measures must be implemented based on the risk assessment and applicable regulations .

Researchers should consult their institution's Environmental Safety office or equivalent department for guidance on registration requirements for specific experiments involving recombinant psbD .

What are the critical factors for successful purification of recombinant Saccharum hybrid D2 protein?

Successful purification of recombinant Saccharum hybrid D2 protein requires careful attention to several critical factors:

Purification StageCritical FactorsMethodological Recommendations
Cell LysisMembrane protein solubilizationUse specialized detergents (DDM, LDAO, or C12E8) at optimized concentrations
Affinity ChromatographyHis-tag accessibilityEmploy IMAC with Ni-NTA resin; consider adding low concentrations of detergent in all buffers
Protein StabilityPrevention of aggregationMaintain temperature at 4°C throughout purification; add glycerol (10-15%) to stabilize
StorageMaintaining functional integrityStore as lyophilized powder or in aliquots at -80°C to prevent repeated freeze-thaw cycles
Quality ControlPurity assessmentVerify >90% purity by SDS-PAGE before experimental use

When working with the purified recombinant D2 protein, researchers should be aware that repeated freezing and thawing can compromise protein quality. For short-term work, maintaining working aliquots at 4°C for up to one week is recommended .

How can researchers address challenges in studying protein-protein interactions involving the D2 protein in PSII assembly?

Studying protein-protein interactions involving the D2 protein in PSII assembly presents several challenges due to the membrane-embedded nature of these complexes. Researchers can address these challenges through:

  • Complementary methodological approaches:

    • Blue-native PAGE for preserving native protein complexes and visualizing assembly intermediates

    • Co-immunoprecipitation using antibodies against specific PSII components

    • Proximity labeling techniques such as BioID or APEX2

    • Förster resonance energy transfer (FRET) for analyzing interactions in intact membranes

  • Strategic experimental designs:

    • Compare wild-type systems with mutant strains lacking specific PSII components to identify assembly dependencies

    • Use pulse-chase radiolabeling to track the temporal sequence of interactions

    • Apply conditional expression systems to control the timing of D2 protein production

  • Data integration framework:

    • Correlate spectroscopic measurements of PSII function with protein accumulation data

    • Combine structural information from cryo-EM studies with biochemical interaction data

    • Utilize systems biology approaches to model the PSII assembly process

Research has shown that assembly of the reaction center complex is a prerequisite for assembly with core subunits CP47 and CP43, highlighting the sequential nature of these interactions . Researchers should design experiments that can distinguish between direct physical interactions and functional dependencies in the assembly process.

What approaches can resolve contradictory results regarding D2 protein function in different experimental systems?

When facing contradictory results regarding D2 protein function across different experimental systems, researchers should implement a systematic troubleshooting and reconciliation approach:

  • Standardize experimental conditions: Establish identical growth conditions, protein extraction methods, and analytical techniques across different experimental systems to minimize methodological variability.

  • Cross-validate with multiple techniques: Confirm observations using independent experimental approaches (e.g., spectroscopic methods, biochemical assays, and genetic analyses) to identify technique-specific artifacts.

  • Consider genetic background effects: The polyploid nature of Saccharum hybrids may result in allelic variations of psbD that function differently . Sequence the specific psbD alleles being studied in each system to identify potential sequence variations.

  • Evaluate protein microenvironments: Different lipid compositions or redox environments between systems may affect D2 protein function. Analyze the membrane composition and electron transport chain components in each system.

  • Examine post-translational modifications: Compare post-translational modification profiles of the D2 protein across systems using mass spectrometry, as these modifications may affect function.

  • Assess interaction partners: Variations in accessory proteins or assembly factors between systems may influence D2 function. Perform comparative interactome analyses to identify differential interaction partners.

By systematically addressing these factors, researchers can identify the source of contradictory results and develop a more unified understanding of D2 protein function across experimental systems.

How can understanding psbD regulation in Saccharum hybrids contribute to developing climate-resilient sugarcane varieties?

Understanding psbD regulation in Saccharum hybrids has significant potential for developing climate-resilient sugarcane varieties through several research pathways:

  • Enhanced photosynthetic efficiency: The D2 protein plays a critical role in PSII assembly and function . Identifying regulatory elements and allelic variants that optimize D2 accumulation could lead to improved photosynthetic performance under variable environmental conditions.

  • Stress tolerance engineering: By characterizing how environmental stresses affect psbD expression and D2 protein accumulation, researchers can identify genotypes with superior PSII repair mechanisms under high light, temperature fluctuations, or drought conditions.

  • Cytoplasmic contribution exploitation: Development of Saccharum hybrids with S. spontaneum cytoplasm has enhanced genetic diversity in sugarcane germplasm . This approach can be leveraged to incorporate cytoplasmic factors that regulate psbD expression in ways that confer environmental resilience.

  • Strategic introgression: The allele-defined genome of S. spontaneum provides tools to track the introgression of chromosomes carrying beneficial psbD alleles into modern sugarcane varieties . The random distribution of introgressed S. spontaneum chromosomes in modern sugarcanes indicates opportunities for targeted breeding approaches .

  • Molecular marker development: Designing molecular markers linked to beneficial psbD alleles can accelerate selection of climate-resilient varieties through marker-assisted breeding programs .

This research direction holds particular promise as modern sugarcanes already combine traits from different Saccharum species - high sugar content from S. officinarum with hardiness and disease resistance from S. spontaneum . Extending this approach to specifically target photosynthetic efficiency through psbD regulation represents a logical advancement in sugarcane improvement strategies.

What are the most promising experimental approaches for investigating the interaction between D2 protein accumulation and environmental stress responses?

Investigating the relationship between D2 protein accumulation and environmental stress responses requires sophisticated experimental approaches that can capture the dynamic nature of PSII regulation:

  • Controlled environment stress experiments:

    • Subject Saccharum hybrids to precisely controlled stress conditions (high light, temperature extremes, drought)

    • Monitor D2 protein accumulation using quantitative western blotting

    • Correlate changes with PSII function using chlorophyll fluorescence measurements

    • Compare responses across genotypes with different psbD alleles

  • Transcriptional regulation analysis:

    • Employ RNA-seq to characterize transcriptional changes in psbD and related genes

    • Use chromatin immunoprecipitation (ChIP) to identify stress-responsive transcription factors that bind psbD regulatory regions

    • Develop reporter gene constructs to validate regulatory element function under stress conditions

  • Protein turnover studies:

    • Implement pulse-chase experiments to measure D2 protein synthesis and degradation rates under stress

    • Use proteasome inhibitors to determine the contribution of protein degradation to changes in D2 levels

    • Identify post-translational modifications that may signal D2 for degradation during stress

  • Comparative genomic approaches:

    • Leverage the allele-defined genome of S. spontaneum to identify natural variation in psbD sequences and regulatory elements

    • Compare stress responses across diverse Saccharum germplasm to identify superior alleles

    • Use genome editing to validate the contribution of specific sequence variations to stress tolerance

  • Systems biology integration:

    • Combine transcriptomic, proteomic, and metabolomic data to build predictive models of PSII regulation under stress

    • Identify regulatory networks controlling D2 accumulation

    • Validate model predictions through targeted genetic manipulations

These approaches can reveal mechanisms by which environmental stresses affect D2 protein accumulation and PSII assembly, providing targets for genetic improvement of photosynthetic stability under adverse conditions.

What are the key considerations for designing comprehensive research programs on recombinant Saccharum hybrid Photosystem II D2 protein?

Designing comprehensive research programs focused on recombinant Saccharum hybrid Photosystem II D2 protein requires integration of multiple scientific disciplines and consideration of several key factors:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.