Recombinant Saccharum hybrid Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for precise delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
psbA; PS082; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Saccharum hybrid (Sugarcane)
Target Names
psbA
Target Protein Sequence
TAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein (psbA) and what is its function?

The Photosystem Q(B) protein, also known as psbA or D1 protein, is a 32 kDa thylakoid membrane protein that serves as one of the two reaction center proteins of Photosystem II (PSII). In Saccharum hybrid (sugarcane), this protein is essential for photosynthetic electron transport. The D1 protein forms a heterodimer with psbB and provides ligands for the Mn-cluster of the oxygen-evolving complex. This protein-complex binds P680, the primary electron donor of PSII, and shares a non-heme iron while binding additional chlorophylls and pheophytin .

The primary function of psbA is to facilitate electron transport in the photosynthetic apparatus. It serves as a binding site for herbicides such as atrazine, which can block electron transport when attached to the protein . The protein is critical for oxygenic photosynthetic electron transport and thus essential for photoautotrophic growth .

Where is the psbA protein localized in plant cells?

The Photosystem Q(B) protein (psbA) is specifically localized in the chloroplast, primarily embedded in the thylakoid membrane with portions extending into the thylakoid lumen . This strategic positioning enables the protein to participate effectively in photosynthetic electron transport chains. The protein's location is critical for its function, as it allows it to interact with other components of the photosynthetic apparatus and participate in energy conversion processes.

How can different psbA variants be quantified in experimental samples?

The quantification of different psbA variants presents a significant challenge due to their high sequence homology. A successful method for accurate quantification involves reverse phase-LC-electrospray mass ionization-MS/MS (RP-LC-ESI-MS/MS). This technique enables precise differentiation between highly similar protein variants that cannot be distinguished by conventional methods .

The methodology involves:

  • Protein extraction from the sample

  • Digestion with appropriate proteases to generate peptide fragments

  • Separation of peptides using reverse-phase liquid chromatography

  • Analysis by tandem mass spectrometry

  • Identification of variant-specific peptide markers

  • Quantification based on the intensity of these marker peptides

This approach allows researchers to compare transcript and protein levels with unprecedented accuracy. For example, in Thermosynechococcus elongatus under high light conditions, approximately 70% PsbA3 was detected using this method, which closely corresponded to transcript levels measured independently .

What are the best expression systems for producing recombinant psbA protein?

The expression of recombinant psbA protein presents several challenges due to its membrane-embedded nature and complex folding requirements. Chloroplast-based expression systems have proven particularly effective for producing functional psbA protein.

Successful expression strategies include:

  • Microalgal chloroplast expression: Systems using Chlamydomonas reinhardtii have shown promise, particularly when utilizing the 16S/atpA promoter/UTR combination. This approach enables heterologous protein production in photosynthetic-competent strains .

  • Promoter optimization: Fusion of the strong 16S rRNA promoter to the 5' UTR of specific genes can significantly boost mRNA levels and heterologous protein accumulation. The 16S/atpA promoter/UTR combination has shown capability of driving protein accumulation to levels close to those achieved with psbA in a psbA-deficient background .

  • Genetic background considerations: When using psbA promoter/5' UTR for expression, a psbA-deficient genetic background may be required to avoid auto-attenuation mechanisms. The psbA 5' UTR is a primary target for D1-dependent auto-repression, which can silence expression in the presence of wild-type D1 protein .

These approaches enable the production of sufficient quantities of recombinant protein for biochemical and structural studies.

What methods can be used to assess the functional activity of recombinant psbA proteins?

Several experimental approaches are effective for assessing the functional activity of recombinant psbA proteins:

  • Thermoluminescence and delayed fluorescence measurements: These techniques can detect shifts in the free energy between redox pairs in different psbA variants. For example, differences between PsbA1 and PsbA3 complexes have been successfully characterized using these methods .

  • Flash-induced fluorescence decay: This approach allows measurement of electron transfer between the QA and QB sites, which is a critical function of the psbA protein. This technique can determine if recombinant variants maintain normal electron transfer capabilities .

  • Prompt fluorescence measurements: These provide information about the initial photochemical reactions in Photosystem II and can identify functional differences between protein variants .

  • Herbicide binding assays: Since psbA is a target for herbicides like atrazine, binding studies with these compounds can verify the proper folding and functional state of recombinant psbA proteins .

  • Photoautotrophic growth complementation: Testing the ability of recombinant psbA to support photoautotrophic growth in psbA-deficient organisms provides a definitive functional assessment .

How do different psbA gene variants influence photosynthetic efficiency and stress responses?

Photosynthetic organisms often contain multiple psbA genes encoding slightly different D1 protein variants, which appears to be an evolutionary strategy for adaptation to varying environmental conditions. Research has revealed several significant differences in how these variants influence photosynthesis:

  • Light response adaptations: In Thermosynechococcus elongatus, the PsbA3 variant is strongly induced under high light conditions, while PsbA1 is the standard copy expressed under normal conditions. The PsbA3 complexes provide better protection against photoinhibition due to a higher probability of harmless dissipation of excess energy .

  • Redox potential differences: Studies using thermoluminescence and delayed fluorescence measurements have demonstrated a shift in the redox potential of pheophytin toward more positive values in PsbA3 complexes compared to PsbA1. This shift changes the free energy between redox pairs, affecting electron transport properties and energy dissipation mechanisms .

  • Stress-specific variants: Some psbA variants, like PsbA2 in T. elongatus (D1'), appear to be induced under specific stress conditions such as microaerobic environments. Despite their low expression levels under normal conditions, these variants likely play important roles in adaptation to changing environments .

  • Functional redundancy: In organisms like Anacystis nidulans R2, which contains three psbA genes, inactivation studies have shown that each gene is capable of producing sufficient functional QB protein to support normal photoautotrophic growth. This redundancy suggests a sophisticated regulatory system that can maintain photosynthetic capacity under varying conditions .

These findings highlight the importance of psbA gene diversity in photosynthetic adaptation and stress response, offering potential applications in engineering plants with enhanced stress tolerance.

What structural differences exist between psbA variants and how do they affect herbicide binding?

Structural differences between psbA variants have significant implications for herbicide binding and resistance:

  • Variant-specific amino acid changes: In organisms with multiple psbA genes, the encoded proteins can differ by several amino acids. For example, in Anacystis nidulans R2, the protein encoded by psbAI differs from that encoded by psbAII and psbAIII by 25 out of 360 residues .

  • Herbicide binding site alterations: The psbA protein is the target for several herbicides that bind directly to the photosynthetic apparatus and block electron transport. Specific amino acid substitutions in the protein can alter the binding affinity for herbicides like atrazine .

  • Three-dimensional conformational changes: Even small differences in primary sequence can lead to subtle but significant changes in protein folding and the accessibility of binding pockets. These structural variations affect not only herbicide binding but also the protein's interaction with other components of the photosynthetic apparatus.

  • Functional consequences: Structural variations between psbA variants correlate with differences in redox properties, energy dissipation capabilities, and resistance to photoinhibition. For instance, the structural differences in PsbA3 compared to PsbA1 result in a shift in the redox potential of pheophytin, which affects the energy flow within Photosystem II .

Understanding these structural differences provides valuable insights for designing herbicide-resistant crops and developing new herbicides with specific targeting properties.

How can recombinant psbA proteins be used for studying photoinhibition mechanisms?

Recombinant psbA proteins serve as powerful tools for investigating photoinhibition mechanisms through several approaches:

These approaches contribute to our understanding of photoinhibition mechanisms and inform strategies for improving crop photosynthetic efficiency under varying environmental conditions.

How can gene editing technologies be applied to modify psbA genes for enhanced photosynthetic traits?

Gene editing technologies offer unprecedented opportunities for modifying psbA genes to enhance photosynthetic traits:

These approaches could lead to crops with improved photosynthetic efficiency, enhanced stress tolerance, and increased yield under suboptimal conditions.

What are the implications of psbA sequence variations for evolutionary adaptation to environmental stresses?

The presence of multiple psbA genes in many photosynthetic organisms provides insights into evolutionary adaptation strategies:

  • Adaptive radiation of gene families: The existence of psbA gene families in cyanobacteria and some plants suggests that gene duplication followed by functional divergence has been an important mechanism for adaptation to varying environmental conditions. Each variant appears specialized for specific conditions, such as PsbA3 for high light and PsbA2 for microaerobic conditions in T. elongatus .

  • Sequence conservation patterns: Comparative analysis of psbA sequences across species reveals highly conserved regions essential for basic function, alongside variable regions that likely represent adaptations to specific environmental niches. This pattern of conservation and variation reflects the balance between maintaining core functionality and enabling environmental adaptation.

  • Regulatory evolution: The sophisticated transcriptional control of different psbA variants demonstrates the importance of regulatory evolution in photosynthetic adaptation. For example, the differential expression of psbA genes in Anacystis nidulans R2 shows how organisms can adjust their photosynthetic apparatus through transcriptional regulation .

  • Convergent evolution: Similar patterns of psbA variation have emerged independently in different lineages of photosynthetic organisms, suggesting that certain solutions to environmental challenges have been repeatedly selected during evolution.

  • Horizontal gene transfer: Evidence suggests that some psbA variants may have been horizontally transferred between distantly related photosynthetic organisms, potentially accelerating adaptation to new environments.

Understanding these evolutionary patterns provides insights into natural strategies for photosynthetic optimization and can guide biomimetic approaches to crop improvement.

What critical amino acid residues determine the functional properties of psbA?

The functional properties of psbA are determined by specific amino acid residues that play critical roles in its various activities:

  • Herbicide binding residues: Several amino acid positions in the D1 protein are known to be involved in herbicide binding. Mutations in these residues can confer herbicide resistance by reducing binding affinity while potentially maintaining normal electron transport function .

  • Redox-active residues: Specific amino acids participate directly in electron transfer reactions or influence the redox potentials of cofactors. For example, differences in amino acid composition between PsbA1 and PsbA3 variants result in a shift in the redox potential of pheophytin, affecting energy dissipation capabilities .

  • Mn-cluster coordination sites: Amino acids that provide ligands for the Mn-cluster are essential for water splitting and oxygen evolution. Any alterations to these residues can dramatically affect photosynthetic capacity.

  • Transmembrane domain residues: The proper folding and insertion of psbA into the thylakoid membrane depends on the hydrophobic character of its transmembrane domains. These regions also form the binding pockets for plastoquinone and other cofactors.

  • Protein-protein interaction interfaces: Residues involved in interactions with other photosystem components, such as the D2 protein, affect the assembly and stability of the photosynthetic apparatus.

Understanding these structure-function relationships is essential for rational design approaches aiming to enhance photosynthetic properties through targeted modifications of the psbA protein.

How do post-translational modifications affect psbA function and turnover?

Post-translational modifications play important roles in regulating psbA function and turnover, particularly in response to changing environmental conditions:

  • Phosphorylation: Specific serine and threonine residues in the psbA protein can be phosphorylated, affecting protein-protein interactions and potentially influencing the repair cycle of Photosystem II under stress conditions.

  • Oxidative modifications: As a protein at the center of water-splitting reactions, psbA is particularly susceptible to oxidative damage, especially under high light conditions. These modifications often trigger the degradation and replacement of the D1 protein as part of the PSII repair cycle.

  • Proteolytic processing: The turnover of damaged psbA involves specific proteases that recognize oxidatively modified proteins. The efficiency of this process is crucial for maintaining photosynthetic function under stress conditions.

  • Disulfide bond formation: Cysteine residues in psbA can form disulfide bonds that influence protein conformation and stability. The redox state of these cysteines may serve as a regulatory mechanism responding to changes in the cellular redox environment.

  • N-terminal processing: In some organisms, the initial psbA translation product undergoes N-terminal processing to produce the mature, functional protein. This processing can be affected by environmental conditions and cellular redox state.

These modifications create an additional layer of regulation beyond transcriptional control, allowing rapid adjustments to protein function in response to environmental changes.

How do psbA variants differ between cyanobacteria, algae, and higher plants?

Comparative analysis reveals both conservation and divergence in psbA across different photosynthetic lineages:

These differences reflect the evolutionary history of photosynthetic organisms and provide insights into the adaptability of the photosynthetic apparatus across diverse ecological niches.

What research techniques are most effective for comparing functional properties of psbA variants across species?

Several complementary approaches enable effective comparison of psbA variants across species:

  • Heterologous expression systems: Expressing psbA variants from different species in a common genetic background (such as a psbA-deficient mutant) allows direct functional comparison while controlling for other genetic variables. The 16S/atpA promoter/UTR system has been shown effective for heterologous expression in chloroplasts .

  • Chimeric protein analysis: Creating chimeric proteins by combining domains from psbA variants of different species helps identify which regions are responsible for specific functional properties. This approach has been valuable for mapping herbicide resistance determinants.

  • Comparative spectroscopy: Techniques such as thermoluminescence, delayed fluorescence, and flash-induced fluorescence decay provide detailed information about electron transfer properties and can reveal functional differences between psbA variants from different species .

  • In silico molecular dynamics simulations: Advanced computational approaches can model the structural dynamics of different psbA variants based on their amino acid sequences, providing insights into functional differences that may be difficult to assess experimentally.

  • Comparative genomics and transcriptomics: Analyzing the evolutionary conservation patterns and expression profiles of psbA genes across species reveals adaptation strategies and can identify convergent evolutionary solutions to similar environmental challenges.

These complementary approaches provide a comprehensive understanding of how psbA variants have evolved to optimize photosynthetic function in different ecological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.