Recombinant Saccharum officinarum ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Production Methodology

The recombinant atpI is produced through bacterial expression systems optimized for hydrophobic membrane proteins:

StepProcessOutcomeSource
Gene CloningCodon-optimized gene inserted into plasmidEnhanced expression in E. coli
Solubility EngineeringFusion with maltose-binding protein (MBP)Soluble expression of membrane protein
PurificationNickel-affinity chromatography (His-tag)>90% purity, mg-scale yields

This approach mirrors strategies used for other membrane-bound ATP synthase subunits (e.g., subunit c in spinach) , demonstrating cross-species applicability.

Functional Significance in ATP Synthase

ATP synthase generates ATP in chloroplasts via proton translocation across the thylakoid membrane. The atpI subunit (subunit a) plays a critical role:

ComponentFunctionRelevance to atpISource
F₀ SectorProton channel and rotor/stator interfaceSubunit a forms part of the stator
Proton TranslocationDrives ATP synthesis via electrochemical gradientDirectly involved in H⁺ transport
C-ring InteractionModulates c-ring stoichiometry (cₙ)Affects ATP/H⁺ ratio in different organisms

In sugarcane, the atpI subunit’s structure and function are evolutionarily conserved, as seen in other plants like Spinacia oleracea (spinach) .

Research Applications

The recombinant atpI is used to study:

ApplicationDetailsSource
Structural BiologyNMR/X-ray crystallography of F₀-F₁ interactions
Bioenergy ResearchOptimizing ATP yield in biofuel crops
Protein EngineeringMutagenesis to alter c-ring stoichiometry

Studies on related subunits (e.g., ATPC1 in Arabidopsis) highlight broader roles in organelle RNA editing and stress response , suggesting potential interdisciplinary applications for atpI.

Comparative Analysis with Related Proteins

SubunitOrganismUniProt IDKey FeatureSource
atpI (subunit a)S. officinarumQ6ENW9His-tagged, full-length
atpH (subunit c)S. officinarumQ6ENW8Lipid-binding, F₀ sector
ATPC1 (subunit γ)Arabidopsis thalianaNot providedRegulates RNA editing

This table underscores the modular nature of ATP synthase and the specialized roles of its subunits.

Challenges and Future Directions

  • Expression Challenges: Hydrophobicity complicates solubility in E. coli, requiring fusion partners like MBP .

  • Functional Studies: Limited direct data on S. officinarum atpI necessitates extrapolation from homologs .

  • Agricultural Implications: Engineering atpI to enhance ATP synthesis could improve sugarcane biomass for biofuels .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that you might have specific requirements. Please include any special format requests in your order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please consult your local distributor for the most accurate delivery timeline.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional charges will apply for dry ice shipments.
Notes
Avoid repeated freezing and thawing. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, and you may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is recommended. To maintain optimal quality, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type preferences, please inform us, and we will prioritize fulfilling your request.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Saccharum officinarum (Sugarcane)
Target Names
atpI
Target Protein Sequence
MNITPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVIIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
As a key component of the proton channel, this protein plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of ATP synthase subunit a (atpI) in chloroplastic energy metabolism?

The ATP synthase subunit a (atpI) is an integral membrane component of the Fo portion of ATP synthase that plays a critical role in proton translocation. In chloroplasts, this protein participates in harnessing the proton gradient established during photosynthetic electron transport to drive ATP synthesis. The subunit a forms part of the proton channel, working cooperatively with the c-ring to convert the proton motive force into mechanical energy that drives the conformational changes needed for ATP synthesis in the F1 portion of the enzyme. Similar to what has been observed in yeast ATP synthase, the removal or mutation of critical subunits can uncouple ATP synthesis from the proton motive force . Understanding atpI's precise function is essential for comprehending the bioenergetic processes in sugarcane chloroplasts.

How does the structure of Saccharum officinarum atpI compare to other homologous chloroplastic proteins?

While specific structural data for Saccharum officinarum atpI is limited, comparative analysis with other chloroplastic ATP synthase subunit a proteins reveals certain conserved features. Like its homologues in other plant species, the Saccharum officinarum atpI likely contains multiple transmembrane helices that collectively form the proton channel. The protein's structure is inherently related to its function, with specific regions involved in proton translocation. The structural similarity to ATP synthase components in other organisms, such as the F6 subunit in bovine enzyme that shows homology to subunit h in yeast , suggests evolutionary conservation of functionally important domains. Structural models of peripheral stalk regions close to the Fo membrane domain provide insights into how these components interact with the membrane-embedded subunits like atpI.

What experimental approaches can verify the subcellular localization of recombinant atpI?

Verification of chloroplastic localization for recombinant atpI requires multiple complementary approaches:

  • Confocal microscopy with fluorescent tagging: Express atpI fused to GFP or similar fluorescent proteins and visualize co-localization with chloroplast markers.

  • Subcellular fractionation: Isolate chloroplasts from transgenic plants expressing the recombinant protein, followed by western blotting against either the native protein or epitope tags.

  • Biotinylation tagging: Similar to approaches used with the yeast ATP synthase subunit h , introducing a biotinylation signal at the C-terminus of atpI enables avidin binding for detection and localization studies. This approach has proven effective for locating subunits within the peripheral stalk region close to the membrane domain.

  • Immunogold electron microscopy: This technique provides nanometer-resolution localization of the protein within the chloroplast thylakoid membrane.

What expression systems yield optimal results for recombinant Saccharum officinarum atpI?

Based on successful approaches with other hydrophobic membrane proteins, E. coli expression systems represent a primary choice for atpI expression. The methodological approach would involve:

  • Codon optimization: Similar to methods used for spinach c1 subunit expression, codon optimization for E. coli is crucial for efficient expression of plant proteins .

  • Fusion protein strategy: Expression as a fusion protein with solubility enhancers such as MBP (maltose binding protein) significantly improves the solubility of hydrophobic membrane proteins. This strategy has been successfully employed for the recombinant production of spinach chloroplast ATP synthase c1 subunit .

  • Expression vector selection: BL21 derivative Escherichia coli cells have demonstrated successful expression of eukaryotic membrane proteins from chloroplast ATP synthase .

  • Induction conditions: Carefully optimized temperature, IPTG concentration, and induction time are critical for proper folding and preventing inclusion body formation.

This methodology enables the soluble expression of hydrophobic chloroplastic membrane proteins, avoiding common pitfalls associated with membrane protein expression.

What purification strategy yields the highest purity and structural integrity of atpI?

A multi-step purification approach is recommended for atpI:

  • Initial affinity purification: If expressed as an MBP fusion protein, maltose affinity chromatography provides an efficient first purification step.

  • Protease cleavage: Controlled proteolytic cleavage to separate atpI from its fusion partner, similar to the approach used for spinach c1 subunit .

  • Reversed-phase chromatography: This has proven effective for the final purification of highly hydrophobic ATP synthase subunits, yielding significant quantities of highly purified protein .

  • Quality control: Secondary structure verification using circular dichroism spectroscopy to confirm the correct alpha-helical structure, as demonstrated for the c1 subunit .

This sequential purification strategy effectively balances protein yield with structural integrity, critical for downstream functional studies.

How can researchers verify the functional integrity of purified recombinant atpI?

Verification of functional integrity requires multiple complementary approaches:

  • Secondary structure analysis: Circular dichroism spectroscopy to confirm the alpha-helical secondary structure characteristic of membrane-embedded ATP synthase subunits.

  • Reconstitution assays: Incorporation of purified atpI into liposomes or nanodiscs, followed by proton translocation assays.

  • Complementation studies: Evaluation of whether the recombinant protein can restore function in systems with deleted or mutated native atpI genes, similar to how F6 can replace the function of subunit h in yeast ATP synthase .

  • Binding studies: Assessment of interaction with other ATP synthase subunits, particularly those that form the proton channel and peripheral stalk.

  • ATP synthesis measurement: Ultimate verification through ATP synthesis assays in reconstituted systems containing the purified recombinant protein.

How can site-directed mutagenesis of atpI advance understanding of proton translocation mechanisms?

Site-directed mutagenesis represents a powerful approach for structure-function analysis of atpI's role in proton translocation:

This approach can reveal the precise molecular mechanism of how proton flow through atpI drives ATP synthesis, similar to how studies of subunit h have advanced understanding of peripheral stalk functions .

What techniques are most effective for studying protein-protein interactions between atpI and other ATP synthase components?

Multiple complementary approaches can effectively characterize atpI interactions:

These methods collectively provide a comprehensive view of how atpI integrates into the ATP synthase structure and contributes to its function.

How does recombinant atpI compare to native protein in terms of post-translational modifications and functional properties?

Comparative analysis between recombinant and native atpI should address:

  • Post-translational modification profiling: Mass spectrometry-based proteomics to identify and quantify modifications present in native but potentially absent in recombinant protein.

  • Functional comparison: ATP synthesis rates, proton translocation efficiency, and oligomeric assembly properties between native and recombinant proteins.

  • Structural assessment: Circular dichroism and potentially cryo-electron microscopy to compare structural features.

  • Thermal stability analysis: Differential scanning calorimetry to assess potential differences in protein stability that might reflect modification status.

  • Interaction profiling: Comparative binding assays with other ATP synthase subunits to determine if recombinant protein maintains all interaction capabilities.

This comprehensive analysis ensures that experimental findings with recombinant protein accurately reflect the native protein's behavior in vivo.

How can researchers interpret kinetic data from ATP synthase assays incorporating recombinant atpI?

Proper interpretation of kinetic data requires consideration of several factors:

Kinetic analysis should be complemented with structural data to establish structure-function relationships, similar to the approach used in studies of yeast ATP synthase peripheral stalk regions .

What methodological approaches can address the challenge of membrane protein reconstitution for functional assays?

Effective reconstitution strategies should include:

  • Lipid composition optimization: Testing various lipid mixtures mimicking the native thylakoid membrane environment, including appropriate phospholipids and galactolipids.

  • Protein-to-lipid ratio screening: Systematic variation of this ratio to determine optimal reconstitution conditions.

  • Reconstitution method selection: Comparison of detergent dialysis, direct incorporation, and liposome fusion methods to identify the most effective approach.

  • Orientation control: Techniques to ensure proper orientation of reconstituted atpI with respect to the membrane.

  • Functional verification: Proton gradient formation assays using pH-sensitive fluorescent dyes to confirm functional reconstitution.

This methodical approach addresses a key challenge in membrane protein biochemistry that directly impacts downstream functional assays.

What are the critical parameters for optimizing recombinant atpI expression?

Table 1 summarizes key optimization parameters based on studies with homologous proteins:

ParameterOptimal ConditionEffect on ExpressionRecommended Range for Optimization
Expression HostE. coli C43(DE3)Tolerates membrane protein toxicityC41(DE3), C43(DE3), BL21(DE3) pLysS
Fusion PartnerMBPEnhances solubility significantlyMBP, SUMO, TrxA
Growth Temperature18-22°CReduces inclusion body formation18-30°C
Induction OD6000.6-0.8Balances biomass and expression efficiency0.4-1.0
IPTG Concentration0.1-0.2 mMModerate induction reduces aggregation0.05-0.5 mM
Post-induction Time16-20 hoursAllows slow accumulation of properly folded protein4-24 hours
Medium CompositionTerrific Broth + 0.5% glucoseProvides metabolic energy for proper foldingLB, TB, 2xYT with glucose supplementation

These parameters draw on successful approaches for expressing membrane proteins from ATP synthase complexes, including the methodology that enabled soluble expression of eukaryotic membrane proteins in E. coli cells .

How does Saccharum officinarum ATP synthase compare structurally and functionally to other plant ATP synthases?

Comparative analysis reveals important evolutionary and functional insights:

Table 2: Comparative Analysis of Plant ATP Synthase Properties

SpeciesATP Synthase c-ring StoichiometryProton:ATP RatioKey Structural FeaturesAdaptation to Environmental Conditions
Saccharum officinarum (Sugarcane)14*4.7:1*Specialized peripheral stalkAdapted to high light intensity environments
Spinacia oleracea (Spinach)144.7:1Well-characterized c1 subunit with alpha-helical structure Moderate light adaptation
Arabidopsis thaliana144.7:1Model system with extensive mutational studiesAdaptable to varying conditions
C4 photosynthetic plants13-14*4.3-4.7:1*Enhanced ATP synthesis capacityHigh-temperature and light adaptation
C3 photosynthetic plants144.7:1Conserved structure across speciesModerate temperature adaptation

*Estimated based on related C4 plants; exact values require experimental determination

This comparative approach highlights the relationship between ATP synthase structure and metabolic adaptation, providing context for understanding the specific features of Saccharum officinarum ATP synthase.

How might structural biology approaches advance understanding of atpI function?

Future research directions should leverage cutting-edge structural biology techniques:

  • Cryo-electron microscopy: This rapidly advancing technique could determine the structure of intact Saccharum officinarum ATP synthase, revealing the precise position and conformation of atpI within the complex.

  • X-ray crystallography of isolated subunit: While challenging for membrane proteins, this approach could provide atomic-resolution information about key functional domains.

  • Solid-state NMR: This technique is particularly valuable for membrane proteins and could reveal dynamic aspects of atpI structure during proton translocation.

  • Molecular dynamics simulations: Computational approaches can model proton movement through the atpI channel, providing insights difficult to obtain experimentally.

  • In situ structural studies: Emerging techniques for studying protein structures within intact organelles could reveal native conformations and interactions.

These approaches would extend current understanding beyond the electron microscopy and image analysis techniques used for localizing subunits in ATP synthase complexes .

What are the implications of atpI research for understanding bioenergetic adaptation in Saccharum officinarum?

Research on atpI has broader implications for plant bioenergetics:

  • Photosynthetic efficiency: Understanding how ATP synthase structure affects the ATP:NADPH ratio produced during photosynthesis, potentially explaining Saccharum officinarum's high photosynthetic efficiency.

  • Environmental adaptation: How structural variations in atpI might contribute to sugarcane's adaptation to high-light tropical environments.

  • Metabolic integration: Connections between ATP synthesis rate and the enhanced glucose metabolism pathways that have been observed in sugarcane, similar to the upregulation of glycolytic genes (PGK1, PGAM1, PKM, and PC) observed in neuronal cells treated with sugarcane extract .

  • Crop improvement strategies: How understanding ATP synthase function could inform breeding or engineering approaches to enhance sugarcane productivity.

  • Comparative bioenergetics: Insights into how C4 plants like sugarcane optimize their energy conversion processes compared to C3 plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.