Recombinant Saccharum officinarum ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharum officinarum ATP Synthase Subunit b, Chloroplastic (atpF)

Recombinant Saccharum officinarum ATP synthase subunit b, chloroplastic (atpF), is a recombinant protein derived from sugarcane (Saccharum officinarum). This protein is part of the ATP synthase complex, which plays a crucial role in generating ATP during photosynthesis in chloroplasts. ATP synthase is essential for converting light energy into chemical energy in the form of ATP, which is vital for plant growth and development.

Structure and Function

ATP synthase is a complex enzyme composed of two main parts: the F1 sector and the F0 sector. The F0 sector is embedded in the thylakoid membrane and is responsible for proton translocation, while the F1 sector is soluble and catalyzes the synthesis of ATP from ADP and inorganic phosphate. The subunit b (atpF) is part of the F0 sector and plays a crucial role in the proton translocation process, which drives ATP synthesis.

CharacteristicsDescription
SpeciesSaccharum officinarum (Sugarcane)
Uniprot IDQ6ENW7
Tag TypeDetermined during production
Storage BufferTris-based buffer, 50% glycerol
Storage ConditionsStore at -20°C or -80°C

Applications and Potential Uses

Recombinant ATP synthase subunits are primarily used in research settings for studying energy metabolism, protein structure, and function. They can also serve as tools for understanding plant physiology and potentially improving crop yields by enhancing photosynthetic efficiency.

ApplicationDescription
ResearchStudying energy metabolism and protein function
Plant PhysiologyUnderstanding photosynthesis and improving crop yields

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Saccharum officinarum (Sugarcane)
Target Names
atpF
Target Protein Sequence
MKNVTHSFVFLAHWPFAGSFGLNTDILATNLINLTVVVGVLIFFGKGVLKDLLDNRKQRI LSTIRNSEELRRGTLEQLEKARIRLQKVELEADEYRMNGYSEIEREKENLINATSISLEQ LEKSKNETLYFEKQRAMNQVRQRVFQQAVQGALGTLNSCLNTELHFRTIRANIGILGAIE WKR
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, encompassing the membrane proton channel. These domains are linked via a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 and F0.
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structural role of the ATP synthase subunit b (atpF) in chloroplasts?

The ATP synthase subunit b (atpF) serves as a critical component of the peripheral stalk in the chloroplastic ATP synthase complex. This stalk functions as a stationary connection between the membrane-embedded FO portion and the catalytic F1 portion of ATP synthase. Unlike the central stalk that rotates during ATP synthesis, the peripheral stalk remains stationary, providing structural stability and preventing unproductive rotation of the F1 head relative to the FO base. In chloroplastic ATP synthase, atpF forms part of this essential connection that enables the enzyme to harness the proton gradient generated during photosynthesis for ATP production .

How does chloroplastic atpF differ from mitochondrial ATP synthase subunits?

Chloroplastic atpF differs from mitochondrial ATP synthase subunits in several key aspects. First, while both participate in ATP synthesis, they operate in different cellular compartments with distinct energy-generating processes - photosynthesis for chloroplasts versus oxidative phosphorylation for mitochondria. Structurally, the chloroplastic atpF is encoded by the chloroplast genome, whereas mitochondrial ATP synthase subunits like ATP5F1B are nuclear-encoded . The chloroplastic atpF typically has different amino acid sequences adapted to the unique lipid environment and pH conditions of the thylakoid membrane. Additionally, chloroplastic ATP synthase complexes may contain unique regulatory mechanisms adapted to modulate activity based on light availability, which is not present in mitochondrial ATP synthases .

What expression systems are commonly used for producing recombinant chloroplastic atpF?

For producing recombinant chloroplastic proteins like atpF, several expression systems have proven effective with modifications to accommodate the unique characteristics of these proteins:

Each system requires optimization of growth conditions, including temperature, induction timing, and media composition to balance between protein yield and proper folding .

What strategies can overcome expression and solubility challenges for recombinant atpF?

Expressing functional recombinant chloroplastic atpF presents several challenges due to its membrane association and involvement in protein complexes. Researchers can implement these strategies to improve outcomes:

  • Fusion tag selection: While 6xHis-tags are common , alternative fusion partners such as MBP (maltose-binding protein) or SUMO can significantly enhance solubility for chloroplastic membrane proteins like atpF.

  • Truncation approaches: Creating constructs that remove highly hydrophobic transmembrane regions while preserving functional domains can improve expression. For atpF, expression of the soluble portion involved in F1 interaction may yield higher protein quantities for structural studies.

  • Co-expression with partner subunits: Similar to approaches with other ATP synthase components, co-expressing atpF with its natural binding partners (e.g., δ-subunit) can improve stability and proper folding .

  • Detergent screening: Systematic evaluation of detergents is crucial when working with membrane-associated proteins like atpF. A panel approach testing different detergent classes (maltoside, glucoside, and zwitterionic detergents) at varying concentrations helps identify optimal solubilization conditions.

  • Inclusion body recovery protocols: When expression leads to inclusion bodies, specialized refolding protocols using gradual dialysis against decreasing concentrations of chaotropic agents, combined with the appropriate redox environment, can recover functional protein.

These approaches may need to be combined and optimized for the specific characteristics of Saccharum officinarum atpF .

How can researchers assess the functional integrity of recombinant atpF?

Verifying the functional integrity of recombinant atpF requires multiple complementary approaches:

  • ATP hydrolysis/synthesis assays: When incorporated into ATP synthase complexes, functional atpF should support ATP synthesis activity. Researchers can measure ATP production using luciferase-based assays when the recombinant protein is reconstituted with other ATP synthase components in liposomes with an established proton gradient.

  • Protein-protein interaction verification: Pull-down assays using tagged recombinant atpF can confirm interactions with known binding partners from the ATP synthase complex, particularly the δ-subunit and other peripheral stalk components .

  • Circular dichroism spectroscopy: This technique assesses secondary structure integrity, particularly important for confirming proper folding of α-helical regions that dominate atpF structure.

  • Thermal shift assays: These provide information about protein stability and can be used to compare recombinant atpF with native protein or to assess stabilization by binding partners.

  • Complementation studies: In systems like Chlamydomonas reinhardtii where ATP synthase mutants are available, testing whether recombinant Saccharum atpF can functionally restore ATP synthase activity in atpF mutants provides strong evidence of functional integrity .

What approaches can resolve contradictory results in atpF functional studies?

When encountering contradictory results in atpF studies, researchers should implement systematic troubleshooting approaches:

  • Multi-method validation: Contradictions often arise when relying on single experimental approaches. Employ multiple independent methods to verify findings, such as combining biochemical assays with structural studies and in vivo functional tests .

  • Context-dependent analysis: ATP synthase function depends on specific lipid environments and protein-protein interactions. Contradictory results may reflect differences in experimental contexts rather than errors. Systematically vary experimental conditions (pH, ionic strength, lipid composition) to determine if contradictions resolve under specific conditions .

  • Species-specific considerations: Comparisons between atpF from different organisms may yield apparent contradictions. Even within bacterial ATP synthases, structural differences exist between phyla . For sugarcane atpF, compare results with other C4 plants before comparing with more distant relatives.

  • Isoform identification: Verify whether contradictory results stem from inadvertent study of different isoforms or splice variants of atpF, particularly when comparing different tissue sources or developmental stages.

  • Confirmation bias awareness: As noted in study , researchers tend to interpret data according to preconceived expectations. When analyzing atpF data with contradictions, deliberately explore multiple alternative hypotheses rather than focusing exclusively on expected outcomes .

A rigorous approach involves creating a matrix of experimental conditions and systematically testing each variable to identify the specific factors responsible for contradictory results.

What crystallization approaches are most effective for recombinant chloroplastic atpF?

Crystallizing membrane-associated proteins like chloroplastic atpF presents significant challenges that require specialized approaches:

  • Lipid cubic phase (LCP) crystallization: This method provides a membrane-mimetic environment particularly suitable for atpF, which interacts with lipid bilayers. The technique involves incorporating the purified protein into a structured lipid mesophase that supports crystal formation while maintaining the protein's native conformation.

  • Co-crystallization with stabilizing partners: Attempting to crystallize atpF in complex with its binding partners, particularly the δ-subunit or other peripheral stalk components, can stabilize its structure and promote crystal formation .

  • Surface entropy reduction: Introducing mutations that reduce surface entropy (replacing flexible, charged residues with alanines) at non-conserved surface-exposed sites can enhance crystallization propensity without affecting protein function.

  • Antibody fragment complexation: Forming complexes with Fab or nanobody fragments that recognize specific epitopes of atpF can provide additional crystal contacts while stabilizing flexible regions.

  • Detergent screening matrix: Testing a diverse panel of detergents, including newer generation detergents like GNG (glucose neopentyl glycol) derivatives, is critical for identifying conditions that maintain atpF stability while permitting crystal contacts.

Successful crystallization typically requires highly pure (>95%) protein preparations and extensive screening of hundreds of conditions, often with iterative optimization rounds .

How can cryo-EM be optimized for studying recombinant atpF in the context of the ATP synthase complex?

Cryo-electron microscopy (cryo-EM) offers significant advantages for studying membrane protein complexes like ATP synthase, with optimization strategies including:

  • Sample homogeneity optimization: Gradient ultracentrifugation followed by size exclusion chromatography can improve sample homogeneity, critical for high-resolution cryo-EM studies of ATP synthase complexes containing recombinant atpF.

  • Amphipol reconstitution: Replacing conventional detergents with amphipathic polymers (amphipols) can enhance stability of the ATP synthase complex during grid preparation, reducing preferential orientation issues common with membrane proteins.

  • Focused refinement protocols: Given the peripheral stalk's inherent flexibility, implementing focused refinement strategies that specifically target the atpF-containing regions can significantly improve local resolution.

  • Nanodisc incorporation: Reconstituting ATP synthase with recombinant atpF into nanodiscs provides a more native-like lipid environment than detergent micelles, potentially preserving physiologically relevant conformations.

  • Time-resolved approaches: For functional studies, emerging time-resolved cryo-EM methods can potentially capture different conformational states of atpF during the ATP synthesis cycle.

These approaches have successfully resolved ATP synthase structures from diverse organisms and can be adapted specifically for studying Saccharum officinarum ATP synthase with recombinant atpF .

What methods effectively assess the interaction between recombinant atpF and other peripheral stalk components?

Several complementary techniques can characterize interactions between recombinant atpF and other peripheral stalk components:

  • Surface plasmon resonance (SPR): Provides quantitative binding kinetics and affinity constants between immobilized atpF and other stalk components in real-time. This technique can determine association/dissociation rates and reveal how mutations affect binding dynamics.

  • Isothermal titration calorimetry (ITC): Offers label-free measurement of binding thermodynamics, providing enthalpy, entropy, and stoichiometry data for atpF interactions.

  • Native mass spectrometry: Enables detection of intact complexes and their stoichiometry, particularly valuable for determining if recombinant atpF forms the correct oligomeric assemblies with partner proteins.

  • Microscale thermophoresis (MST): Requires minimal sample amounts and can detect interactions in near-native conditions, making it suitable for membrane-associated proteins like atpF.

  • Fluorescence resonance energy transfer (FRET): When combined with site-specific fluorescent labeling, FRET can provide spatial information about the arrangement of atpF relative to other subunits within the peripheral stalk.

These methods have been applied to study ATP synthase components from various organisms and can be adapted to investigate specific properties of Saccharum officinarum atpF interactions .

How can researchers investigate the role of atpF in the proton translocation mechanism?

Investigating atpF's contribution to proton translocation requires specialized techniques that connect structural elements to functional outcomes:

  • Site-directed mutagenesis coupled with functional assays: Systematic mutation of conserved residues in atpF, particularly those at interfaces with other subunits, followed by ATP synthesis/hydrolysis assays can identify regions critical for coupling proton movement to catalytic activity.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of atpF that show altered solvent accessibility during different functional states, providing insights into dynamic structural changes during proton translocation.

  • pH-sensitive fluorescent probes: Strategic incorporation of pH-sensitive fluorophores into recombinant atpF or associated components can allow real-time monitoring of local pH changes during ATP synthase operation.

  • Cross-linking mass spectrometry: Applying chemical cross-linkers under different energetic conditions, followed by mass spectrometric analysis, can capture dynamic interactions between atpF and other subunits during the catalytic cycle.

  • Single-molecule FRET studies: These can reveal conformational dynamics of atpF during proton translocation that may not be evident in ensemble measurements.

While these methods have not been specifically reported for sugarcane atpF, they have provided valuable insights into ATP synthase function in other systems .

How does atpF structure and function differ between C3 and C4 plants?

The structural and functional differences in atpF between C3 and C4 plants reflect adaptations to their distinct photosynthetic mechanisms:

FeatureC3 Plant atpFC4 Plant atpF (e.g., Saccharum)
Amino acid compositionTypically contains fewer proline residuesEnhanced proline content providing rigidity to withstand higher energy demands
Post-translational modificationsFewer phosphorylation sitesIncreased regulatory phosphorylation sites for rapid activity modulation
Interaction interface with F1Standard contact surface areaExpanded interaction surface supporting higher ATP synthesis rates
ThermostabilityLower thermostability profileEnhanced thermostability supporting function in higher leaf temperatures typical of C4 plants
Expression levelsLower expression relative to other ATP synthase componentsHigher stoichiometric expression reflecting increased ATP synthase abundance

These differences represent evolutionary adaptations to the higher energy demands and distinct chloroplast environments found in C4 plants like Saccharum officinarum compared to C3 plants. The enhanced structural features of C4 plant atpF support the increased ATP production needed for the energy-intensive C4 carbon fixation pathway .

What evolutionary insights can be gained from comparative analysis of recombinant atpF across different plant species?

Comparative analysis of atpF across diverse plant lineages reveals evolutionary patterns that illuminate both ATP synthase function and plant adaptation:

  • Conserved functional domains: Identifying invariant regions across plant species highlights domains essential for core atpF functions, including specific binding interfaces with the δ-subunit and other peripheral stalk components .

  • Lineage-specific adaptations: Regions showing accelerated evolution in specific plant lineages may represent adaptations to particular environmental conditions. For Saccharum officinarum, these adaptations likely include modifications supporting function in high light intensity and temperature environments.

  • Horizontal gene transfer events: Comparative analysis can reveal potential horizontal gene transfer events between chloroplast and nuclear genomes or between different organisms. Such events may have contributed to ATP synthase evolution and adaptation.

  • Co-evolution patterns: Statistical coupling analysis of atpF with other ATP synthase subunits can identify co-evolving residue networks that maintain critical functional interactions despite sequence divergence.

  • Selection pressure mapping: Calculating dN/dS ratios (non-synonymous to synonymous substitution rates) across atpF sequences can identify regions under positive or purifying selection, revealing evolutionarily important functional domains.

These evolutionary insights contribute to understanding how ATP synthase has adapted to diverse plant physiologies while maintaining its essential function in energy production .

How can researchers design experiments to resolve contradictions in atpF function data?

When faced with contradictory results regarding atpF function, researchers should implement a systematic experimental approach:

  • Multi-system validation: Test atpF function across different experimental systems, including in vitro reconstituted complexes, isolated chloroplasts, and whole-plant studies to determine if contradictions are system-dependent .

  • Controlled variable isolation: Systematically isolate and test individual variables that might explain contradictions, including:

    • Lipid composition of reconstitution systems

    • Redox state of the experimental environment

    • Presence/absence of specific regulatory proteins

    • pH and ion concentrations

  • Direct comparison of native vs. recombinant atpF: Parallel analysis of native Saccharum atpF alongside recombinant protein under identical conditions can determine if contradictions stem from recombinant protein issues .

  • Mutational scanning: Creating a panel of atpF variants with targeted mutations can help map functional domains and identify regions responsible for contradictory results.

  • Interdisciplinary approaches: Combining structural biology, biochemistry, and computational methods provides multiple lines of evidence that can resolve apparent contradictions through more comprehensive understanding .

This systematic approach acknowledges that contradictions often reflect incomplete understanding rather than experimental failure, and can transform contradictions into new insights about atpF function .

What considerations are important when designing site-directed mutagenesis studies for atpF?

Strategic site-directed mutagenesis of atpF requires careful planning to yield meaningful insights:

Combining these considerations with careful experimental design allows researchers to extract maximum information from mutagenesis studies of Saccharum officinarum atpF .

What emerging technologies might advance our understanding of atpF structure and function?

Several cutting-edge technologies hold promise for deepening our understanding of atpF:

  • Time-resolved cryo-EM: Emerging techniques that capture protein dynamics at different time points could reveal the conformational changes in atpF during ATP synthesis, providing unprecedented insights into its mechanical function.

  • AlphaFold and deep learning approaches: As these AI-based structure prediction methods continue to improve, they may provide high-confidence structural models of plant-specific ATP synthase components, including Saccharum atpF, facilitating structure-function studies without crystallization challenges.

  • Single-molecule force spectroscopy: These techniques could directly measure the mechanical properties of the peripheral stalk containing atpF, providing insights into its role in maintaining ATP synthase stability during rotational catalysis.

  • In-cell NMR: Advances in this technique may eventually allow for studying atpF dynamics within intact chloroplasts, bridging the gap between in vitro and in vivo studies.

  • Cryo-electron tomography: Improvements in resolution may soon allow visualization of ATP synthase architecture including atpF within native chloroplast membranes, revealing physiologically relevant arrangements.

These technologies promise to resolve current contradictions and answer fundamental questions about atpF's role in ATP synthase function .

How might research on recombinant atpF contribute to understanding ATP synthase assembly and regulation?

Research on recombinant atpF has significant potential to advance understanding of ATP synthase assembly and regulation through several approaches:

  • Assembly intermediate characterization: By expressing recombinant atpF with various combinations of other ATP synthase subunits, researchers can identify critical assembly intermediates and determine the sequence of assembly events leading to functional enzyme complexes .

  • Regulatory interaction mapping: Pull-down experiments with recombinant atpF can identify novel regulatory proteins that interact with the peripheral stalk, potentially revealing previously unknown regulatory mechanisms specific to plant chloroplastic ATP synthases.

  • Post-translational modification studies: Site-specific incorporation of modified amino acids mimicking phosphorylation or other post-translational modifications can reveal how these modifications alter atpF structure and function, providing insights into regulatory mechanisms.

  • Chimeric protein studies: Creating chimeric proteins containing domains from atpF of different species can help identify species-specific functional adaptations and regulatory mechanisms, particularly when comparing C3 and C4 plant ATP synthases.

  • Structure-guided engineering: Based on structural insights, researchers can engineer modified versions of atpF with altered properties, such as enhanced stability or altered regulatory responses, which can both test hypotheses about natural function and potentially lead to applications in synthetic biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.