Recombinant Saccharum officinarum Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Overview of cemA in Chloroplasts

The cemA protein is integral to chloroplast envelope membranes, playing roles in ion transport and stromal pH regulation . In S. officinarum, chloroplast genomes encode cemA as part of conserved metabolic machinery, with annotated functions in proton extrusion and inorganic carbon uptake . Comparative genomics reveals structural conservation across plants, suggesting similar roles in sugarcane .

Expression Systems

  • Host Organism: Recombinant cemA is typically expressed in Escherichia coli for scalability. For example, rice (Oryza sativa) cemA (P0C302) was produced as a full-length His-tagged protein (1–230 aa) in E. coli .

  • Purification: Affinity chromatography (e.g., Ni-NTA for His tags) achieves >90% purity, confirmed via SDS-PAGE .

Physical Properties

ParameterValue (Rice cemA Example)Source
Molecular Weight~26 kDa (predicted)
Isoelectric PointpI >8.8 (common for transporters)
StabilityLyophilized, stored at -80°C
Reconstitution0.1–1.0 mg/mL in Tris/PBS buffer

Role in Chloroplast Transport

  • Ion Homeostasis: CemA facilitates proton transport, indirectly supporting CO₂ uptake .

  • Membrane Integrity: Integral to maintaining envelope structure, with homologs like IEP60 and IEP45 implicated in metabolite transport .

Experimental Use

  • Protein-Protein Interaction Studies: Used to map envelope transporters via co-immunoprecipitation .

  • Stress Response Analysis: Overexpression in transgenic sugarcane could elucidate drought/salt tolerance mechanisms .

Biotechnological Potential

  • Carbon Concentrating Mechanisms: Engineering cemA may enhance photosynthetic efficiency in sugarcane .

  • CRISPR Editing: S. officinarum transformation platforms (e.g., Lifeasible’s CRISPR systems ) could enable targeted cemA mutagenesis.

Sugarcane vs. Other Species

FeatureS. officinarumOryza sativa (Rice)
Genomic InsertionsDuplicated orf137, rps19 Single-copy cemA
Chloroplast Size142,234 bp (larger LSC region)134,525 bp
Expression HostsUnder developmentE. coli (established)

Challenges and Future Directions

  • Species-Specific Data: No direct studies on recombinant S. officinarum cemA exist; inferences rely on rice and algae homologs .

  • Functional Validation: Requires heterologous expression in sugarcane protoplasts or CRISPR-edited lines .

  • Industrial Relevance: Links to sugarcane bioenergy production (e.g., lignin modification ) remain unexplored.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Saccharum officinarum (Sugarcane)
Target Names
cemA
Target Protein Sequence
MKKKKALPSFLYLVFIVLLPWGVSFSFNKCLELWIKNWWNTRQSETFLTDIQEKRILEGF IELEELFLLDEMIKEKPKTHVQKLPIGIHKEIIQLAKIDNEDHLHIILHFSTNIICLAIL SGSFFLGKEELVILNSWVQEFFYNLNDSIKAFFILLVTDFFVGFHSTRGWELLIRWVYNN LGWAPNELIFTIFVCSFPVILDTCLKFWVFFCLNRLSPSLVVIYHSISEA
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is cemA and what is its significance in Saccharum officinarum?

cemA (chloroplast envelope membrane protein A) is an essential component of the chloroplast envelope membrane in Saccharum officinarum (sugarcane). This protein plays a critical role in maintaining chloroplast integrity and function, particularly in processes related to carbon fixation efficiency. The significance of cemA lies in its involvement in CO₂ uptake mechanisms within the chloroplast, which directly affects photosynthetic efficiency in this economically important C4 plant. Understanding cemA structure and function provides insight into the unique adaptations of Saccharum officinarum's photosynthetic machinery that contribute to its high biomass production capacity.

Similar to other chloroplast envelope proteins characterized in model plants, cemA likely contributes to the specialized membrane transport processes required for efficient photosynthesis . The protein's localization in the chloroplast envelope places it at a strategic interface between the cytosol and the chloroplast interior, making it a key component in metabolite exchange pathways.

How do recombinant cemA proteins differ from native forms?

Recombinant cemA proteins are laboratory-engineered versions that may contain modifications such as affinity tags, optimized codons, or specific mutations designed to enhance expression, facilitate purification, or investigate function. Key differences include:

  • Structural modifications: Recombinant cemA typically includes fusion tags (His, GST, FLAG) that alter the protein's size and potentially its folding dynamics compared to native forms.

  • Post-translational modifications: Native cemA undergoes specific post-translational modifications within the plant cell environment that may be absent or different in recombinant versions expressed in heterologous systems.

  • Functional variations: Depending on the expression system used, recombinant cemA may display altered membrane insertion efficiency, stability, or activity compared to the native protein.

  • Solubility characteristics: Recombinant forms often require optimization to maintain proper folding and membrane integration properties similar to the native protein.

These differences must be carefully considered when designing experiments, as they can significantly impact research outcomes and the biological relevance of findings.

What are the primary methods for isolating chloroplast envelope membranes from Saccharum officinarum?

Isolating chloroplast envelope membranes from Saccharum officinarum requires a multistep approach:

  • Tissue preparation: Young, photosynthetically active leaves are harvested, washed, and cut into small pieces prior to homogenization in an isolation buffer containing sorbitol, HEPES, EDTA, and protease inhibitors.

  • Chloroplast isolation: Differential centrifugation is employed to separate intact chloroplasts from other cellular components. The crude chloroplast fraction is further purified using Percoll gradient centrifugation.

  • Envelope membrane separation: Purified chloroplasts undergo osmotic shock to release thylakoid membranes, followed by sucrose gradient ultracentrifugation to separate outer and inner envelope membranes.

  • Verification of purity: Western blotting using antibodies against known envelope marker proteins is employed to confirm the purity of isolated fractions.

What experimental design considerations are critical when studying recombinant cemA function?

When designing experiments to study recombinant cemA function, researchers should implement:

This comprehensive approach minimizes experimental artifacts and strengthens the internal validity of findings. Particular attention should be given to ensuring that the recombinant protein's membrane insertion occurs properly, as improper localization can lead to misleading functional data.

How can researchers effectively overcome the challenges in expressing functional recombinant cemA?

Expressing functional recombinant cemA presents several challenges that can be addressed through strategic approaches:

Table 1: Strategies to Optimize Recombinant cemA Expression

ChallengeStrategyImplementation Details
Membrane protein insolubilityFusion with solubility tagsExpress cemA with MBP or SUMO tags; optimize tag cleavage conditions post-purification
Toxic effects on host cellsInducible expression systemsUse tight regulatory systems (e.g., Tet-On/Off) with low basal expression
Improper membrane insertionSpecialized expression hostsUtilize chloroplast-like membrane environments in C43(DE3) E. coli strain
Post-translational modification deficienciesPlant-based expression systemsExpress in Nicotiana benthamiana through transient transfection
Low yieldsCodon optimizationAdapt codon usage to expression host; remove rare codons
Protein aggregationDetergent screeningSystematic testing of multiple detergents (DDM, LMNG, GDN) for optimal extraction

Implementation of these strategies requires iterative optimization. Researchers should systematically test variables such as induction temperature, duration, and inducer concentration to identify optimal conditions. For cemA specifically, maintaining the integrity of transmembrane domains during expression is crucial for preserving functional activity.

What are the most reliable approaches for assessing cemA-protein interactions in the chloroplast envelope?

Assessing cemA-protein interactions requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against cemA or potential interacting partners to pull down protein complexes, followed by identification via mass spectrometry. This approach requires careful optimization of detergent conditions to maintain membrane protein interactions.

  • Bimolecular Fluorescence Complementation (BiFC): Split fluorescent protein fragments fused to cemA and candidate interacting proteins can visualize interactions in planta through reconstitution of fluorescence when proteins interact.

  • Proximity-based labeling: Technologies such as BioID or APEX2 fused to cemA can identify proximal proteins through biotinylation, followed by streptavidin pulldown and mass spectrometry analysis.

  • Förster Resonance Energy Transfer (FRET): Measuring energy transfer between fluorophore-tagged proteins to detect interactions with nanometer precision.

  • Crosslinking Mass Spectrometry (XL-MS): Chemical crosslinking followed by mass spectrometry to capture transient interactions within the native membrane environment.

These approaches should be validated through multiple independent methods, as each has specific limitations when applied to membrane proteins like cemA. Integration of interaction data with functional assays strengthens the biological relevance of identified partners.

How should researchers design experiments to characterize the topological orientation of cemA in the chloroplast envelope?

Characterizing cemA topology requires a multi-method approach:

  • Protease protection assays: Treating isolated chloroplasts or reconstituted proteoliposomes with proteases like trypsin or proteinase K, followed by immunoblotting with domain-specific antibodies to determine which regions are accessible.

  • Cysteine scanning mutagenesis: Introducing cysteine residues at various positions throughout cemA, followed by labeling with membrane-impermeable sulfhydryl reagents to identify exposed regions.

  • Fluorescence quenching assays: Incorporating environment-sensitive fluorophores at specific positions in cemA to monitor their accessibility to membrane-impermeable quenchers.

  • Epitope insertion scanning: Introducing small epitope tags (HA, FLAG, etc.) throughout the protein sequence and assessing their accessibility through immunofluorescence in intact and permeabilized chloroplasts.

  • Comparative modeling with validated envelope proteins: Utilizing structural data from well-characterized chloroplast envelope proteins to inform cemA topology predictions .

For accurate topology mapping, researchers should establish proper controls by including proteins with established topologies in the same experimental system. Data from multiple approaches should be integrated to build a comprehensive topological model.

What purification strategies yield the highest purity and functionality for recombinant cemA?

Optimized purification strategies for recombinant cemA include:

  • Two-phase affinity purification: Implementation of tandem affinity tags (e.g., His-MBP or Strep-FLAG) followed by sequential purification steps to maximize purity.

  • Detergent optimization: Systematic screening of detergents (DDM, LMNG, GDN) at various concentrations to identify conditions that maintain protein stability and function.

  • Size exclusion chromatography: Separation of properly folded protein from aggregates and optimization of buffer components to enhance stability.

  • On-column detergent exchange: Gradual transition from extraction detergent to a stabilizing detergent during affinity purification to improve functional yield.

  • Lipid supplementation: Addition of chloroplast-like lipid mixtures during purification to maintain the native-like membrane environment.

Table 2: Optimization Parameters for cemA Purification

ParameterVariables to TestQuality Control Metric
Extraction detergentDDM, LMNG, GDN, DigitoninExtraction efficiency via Western blot
Purification temperature4°C, 16°C, 22°CProtein yield and aggregation state
Buffer pH6.5-8.0 (0.5 increments)Protein stability via thermal shift assay
Salt concentration100-500 mM NaClPurity via SDS-PAGE
Stabilizing additivesGlycerol, arginine, specific lipidsLong-term stability monitoring

Each purification step should be monitored using activity assays specific to cemA to ensure that function is maintained throughout the process. The purification strategy may require customization based on the intended downstream applications.

How can researchers effectively validate antibodies for studying cemA in Saccharum officinarum?

Comprehensive antibody validation requires:

  • Western blot analysis: Testing antibody specificity against recombinant cemA, wild-type chloroplast fractions, and negative controls (knockout/knockdown systems when available).

  • Immunoprecipitation efficiency assessment: Quantifying the percentage of cemA captured from total protein extracts under various conditions.

  • Peptide competition assays: Pre-incubating antibodies with immunizing peptides to confirm signal specificity in both Western blots and immunolocalization studies.

  • Cross-reactivity evaluation: Testing antibodies against closely related proteins or homologs from other species to ensure specificity.

  • Immunolocalization controls: Including appropriate negative controls (pre-immune serum, secondary antibody only) and positive controls (known chloroplast envelope markers) in immunofluorescence or immunogold labeling experiments.

  • Batch-to-batch variation testing: Establishing quality control procedures to monitor consistency across antibody batches.

Proper antibody validation is particularly critical when studying cemA due to potential cross-reactivity with other envelope membrane proteins. Researchers should document and report validation data alongside experimental results to enhance reproducibility.

How should researchers integrate multi-omics data to comprehensively understand cemA function in Saccharum officinarum?

Multi-omics data integration for cemA functional analysis should follow this framework:

  • Sequential data layering: Begin with genomic context (gene structure, regulatory elements), followed by transcriptomic data (expression patterns, co-expression networks), proteomic data (abundance, post-translational modifications), and metabolomic/phenomic data (physiological outcomes).

  • Network analysis: Employ protein-protein interaction networks, metabolic pathway mapping, and gene ontology enrichment to place cemA in its functional context.

  • Comparative analysis across species: Integrate data from model organisms with available envelope proteome studies to identify conserved and divergent features of cemA .

  • Temporal and spatial resolution: Analyze data across developmental stages, tissue types, and subcellular compartments to capture dynamic aspects of cemA function.

  • Environmental response integration: Incorporate data from various stress conditions to understand cemA's role in chloroplast adaptation.

Data integration should be performed using established bioinformatic pipelines with appropriate normalization methods for cross-platform comparisons. The analysis should be iterative, with hypothesis generation and experimental validation cycling to refine understanding of cemA function.

What statistical approaches are most appropriate for analyzing cemA experimental data?

Robust statistical analysis of cemA experimental data should include:

Researchers should clearly describe all statistical methods, including software packages and versions, to enhance reproducibility. For complex datasets, consulting with a biostatistician during experimental design and analysis phases is strongly recommended.

How can contradictory results in cemA functional studies be reconciled?

When facing contradictory results in cemA studies, researchers should:

Table 3: Framework for Reconciling Contradictory cemA Research Findings

Level of AnalysisKey Questions to AddressResolution Approach
TechnicalAre differences due to assay conditions or reagents?Standardized protocols across laboratories
BiologicalAre differences due to biological variation or context?Precise definition and control of biological variables
InterpretativeAre differences due to data analysis or interpretation?Collaborative data re-analysis with standardized methods
ConceptualDo differences reflect genuine biological complexity?Integrated models that incorporate context-dependent function

Contradictory results should be viewed as opportunities to uncover context-dependent aspects of cemA function rather than failures requiring elimination. Developing consensus models that accommodate seemingly contradictory data often leads to deeper biological insights.

What are the most promising approaches for studying cemA structure-function relationships?

Advanced approaches for cemA structure-function analysis include:

  • Cryo-electron microscopy: Utilizing single-particle cryo-EM to determine high-resolution structures of purified cemA in membrane mimetics, potentially revealing functional domains and interaction surfaces.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Mapping dynamic regions and conformational changes in cemA under different physiological conditions without requiring crystallization.

  • Molecular dynamics simulations: Performing computational modeling of cemA in chloroplast-like membrane environments to predict functional motions and lipid interactions.

  • Deep mutational scanning: Systematically introducing mutations throughout cemA and assessing their impact on function through high-throughput functional assays.

  • In vivo FRET sensors: Developing cemA-based biosensors that report on conformational changes or interactions in living plant cells.

How can CRISPR-Cas9 technology be optimized for studying cemA function in Saccharum officinarum?

Optimizing CRISPR-Cas9 approaches for cemA functional studies requires:

  • Genome editing efficiency enhancement:

    • Design multiple sgRNAs targeting different cemA regions

    • Optimize delivery methods specific for Saccharum officinarum tissues

    • Employ ribonucleoprotein (RNP) delivery to reduce off-target effects

  • Precision engineering strategies:

    • Implement base editing or prime editing for precise sequence modifications

    • Design knock-in strategies for fluorescent tagging of endogenous cemA

    • Create conditional knockout systems (e.g., auxin-inducible degron tags)

  • Screening methodology optimization:

    • Develop high-throughput phenotyping approaches specific for chloroplast function

    • Implement digital droplet PCR for detecting editing events

    • Use next-generation sequencing for comprehensive off-target analysis

  • Tissue culture and regeneration protocols:

    • Optimize callus induction from different explant sources

    • Enhance regeneration efficiency through hormone balance optimization

    • Reduce somaclonal variation through careful selection processes

Success with CRISPR-Cas9 in Saccharum officinarum requires addressing its polyploid genome complexity. Researchers should consider targeting conserved regions across homeologs to achieve complete functional knockout or implementing multiplexed editing strategies to target all copies simultaneously.

What experimental approaches can determine the impact of environmental stressors on cemA function?

To assess environmental stress impacts on cemA function, researchers should implement:

  • Controlled stress experiments:

    • Precise application of abiotic stressors (drought, salinity, temperature extremes)

    • Measurement of cemA expression, localization, and post-translational modifications under stress conditions

    • Time-course analysis to capture dynamic responses

  • Functional assays under stress conditions:

    • Chloroplast membrane integrity assessment

    • CO₂ uptake measurements

    • Comparative analysis between wild-type and cemA-modified plants

  • Interaction network dynamics:

    • Proximity labeling under different stress conditions

    • Co-immunoprecipitation followed by mass spectrometry to identify stress-specific interaction partners

    • Phosphoproteomics to detect stress-induced signaling changes affecting cemA

  • Structural adaptations:

    • Monitoring cemA conformational changes using environment-sensitive probes

    • Assessing lipid-protein interactions under stress conditions

    • Evaluating cemA turnover and degradation rates during stress

These approaches should be implemented in both laboratory and field conditions to capture the full spectrum of environmental influences on cemA function. Integration of physiological, molecular, and structural data will provide a comprehensive understanding of how this chloroplast envelope protein contributes to stress adaptation in Saccharum officinarum.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.