Recombinant Saccharum officinarum Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its use.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Saccharum officinarum (Sugarcane)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPTGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex and what role does subunit 4 (petD) play within it?

The Cytochrome b6-f complex is a crucial multi-subunit protein complex located in the thylakoid membrane of chloroplasts that plays an essential role in photosynthetic electron transport. Subunit IV (encoded by the petD gene) is one of the four primary protein components of this complex, alongside cytochrome f, cytochrome b6, and the Rieske Fe-S protein. Subunit IV is integral to the structural integrity and functional efficiency of the complex, participating in the electron transfer process between photosystem II and photosystem I. In comparative studies with other plant species, the absence of subunit IV severely compromises the assembly and stability of the entire complex, leading to increased protein turnover rates and reduced photosynthetic efficiency .

How is the petD gene organized in Saccharum officinarum compared to other plant species?

In Saccharum officinarum, as in most plants, the petD gene is chloroplast-encoded. Research on related species indicates that petD undergoes post-transcriptional processing, particularly RNA splicing, before translation. The gene organization follows a pattern similar to that observed in other monocots, where petB and petD transcripts undergo specific processing events. Comparative analyses with model systems such as Lemna perpusilla demonstrate that while the gene structure may be conserved, the expression levels and processing efficiency can vary significantly between species. Transcription of petD in sugarcane follows patterns typical of plastid genes, with transcripts being processed from polycistronic precursors that may include other genes of the cytochrome complex .

Which expression system is most suitable for producing recombinant Saccharum officinarum petD protein?

The selection of an appropriate expression system for recombinant Saccharum officinarum petD depends on your research objectives:

Bacterial Expression Systems:
E. coli remains the most commonly used host for initial recombinant petD production due to its rapid growth, high protein yields, and well-established protocols. The pET expression system is particularly advantageous as it utilizes the T7 RNA polymerase, which is approximately five times faster than the E. coli RNA polymerase, enabling the generation of large amounts of recombinant RNA in a short period, with recombinant protein potentially constituting up to 50% of the cell's protein content .

  • Codon optimization: Plant chloroplast genes like petD may require codon optimization for efficient expression in E. coli

  • Post-translational modifications: If authentic plant post-translational modifications are required, plant-based expression systems may be more appropriate

  • Membrane protein challenges: As petD encodes a membrane protein component, expression systems designed for membrane proteins should be considered

For functional studies requiring proper folding and assembly into the cytochrome complex, homologous expression in plant systems (such as tobacco chloroplasts) may yield more biologically relevant results.

What strategies can optimize plasmid maintenance when expressing recombinant petD in bacterial systems?

Based on comprehensive studies of pET expression systems, several strategies can enhance plasmid maintenance during recombinant petD expression:

  • Antibiotic selection cassette choice: Research demonstrates significant differences in plasmid maintenance efficiency between Tn3.1-type (β-lactamase, ampicillin resistance) and Tn903.1-type (aminoglycoside-3'-phosphotransferase, kanamycin resistance) genetic fragments. For long-term induction (>20 hours), the choice between these cassettes can significantly impact plasmid retention .

  • Induction timing and duration: Plasmids are efficiently maintained with both resistance cassette types during short induction times (approximately 2 hours), but maintenance efficiency decreases during longer induction periods, particularly with high-level expression of membrane proteins like petD .

  • Host strain selection: The efficiency of plasmid maintenance depends significantly on the host strain used. BL21(DE3) derivatives show varying plasmid retention profiles based on the antibiotic selection cassette employed .

  • Temperature optimization: Lower induction temperatures (16-25°C) can reduce metabolic burden and improve plasmid retention, particularly beneficial for membrane proteins like petD.

  • Media composition adjustment: Supplementing with glucose (0.5-1%) can reduce basal expression from the T7 promoter through catabolite repression, improving plasmid stability.

The following table summarizes plasmid maintenance efficiency in common expression systems:

Expression SystemAntibiotic SelectionPlasmid Maintenance (2h induction)Plasmid Maintenance (20h induction)
pET15b in BL21(DE3)Ampicillin (Tn3.1)>95%65-75%
pET28a in BL21(DE3)Kanamycin (Tn903.1)>95%80-90%
pET15b in C41(DE3)Ampicillin (Tn3.1)>90%70-80%
pET28a in C41(DE3)Kanamycin (Tn903.1)>90%85-95%

What are the most effective purification strategies for recombinant Saccharum officinarum petD protein?

Purification of recombinant Saccharum officinarum petD presents significant challenges due to its hydrophobic nature as a membrane protein component. A multi-stage purification approach is recommended:

  • Membrane fraction isolation: Following cell lysis, differential centrifugation should be employed to isolate membrane fractions containing the petD protein.

  • Detergent selection: Critical for solubilization, detergent screening is essential. Common detergents for cytochrome complex components include:

    • n-Dodecyl β-D-maltoside (DDM): Maintains protein-protein interactions

    • Digitonin: Preserves supramolecular assemblies

    • LDAO: Effective for crystallization attempts

  • Affinity chromatography: Utilizing histidine or other affinity tags engineered into the recombinant construct. Tag positioning requires careful consideration to avoid interfering with protein folding or function.

  • Size exclusion chromatography: Essential for separating monomeric petD from aggregates and validating proper folding.

  • Ion exchange chromatography: As a polishing step to remove contaminants with similar physical properties.

Protein purity should be assessed using SDS-PAGE analysis, with expected molecular weight of approximately 17-19 kDa for the petD subunit. Western blot analysis using antibodies against conserved epitopes of cytochrome b6f subunit IV can confirm identity.

How can researchers assess the proper folding and functionality of recombinant petD?

Assessment of proper folding and functionality requires multiple complementary approaches:

  • Spectroscopic analysis: UV-visible spectroscopy to detect characteristic absorption peaks associated with properly assembled cytochrome complexes. Circular dichroism (CD) spectroscopy to evaluate secondary structure elements.

  • Functional reconstitution: Assembly with other purified components of the cytochrome b6f complex (cytochrome f, cytochrome b6, and Rieske Fe-S protein) to form a functional complex in liposomes or nanodiscs.

  • Electron transfer activity: Measurement of electron transfer rates using artificial electron donors and acceptors to assess functional integrity.

  • Structural integrity assessment: Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine oligomeric state and complex formation.

  • Thermal stability assays: Differential scanning fluorimetry (DSF) or thermal shift assays to evaluate protein stability and proper folding.

A properly folded and functional petD protein should demonstrate:

  • Characteristic spectroscopic signatures

  • Ability to assemble with other subunits

  • Detectable electron transfer activity

  • Appropriate thermal stability profiles comparable to native protein

How can researchers investigate the assembly pathway of the cytochrome b6f complex incorporating recombinant Saccharum officinarum petD?

Investigating the assembly pathway requires a systematic approach combining molecular biology and biophysical techniques:

  • Time-resolved assembly studies: Using pulse-chase experiments with radiolabeled precursors to track the incorporation of recombinant petD into the complex.

  • In vitro reconstitution: Stepwise addition of purified components to determine the sequence of assembly events and identify rate-limiting steps.

  • Mutational analysis: Creating specific mutations in the petD protein to identify regions critical for complex assembly and stability. Studies in model systems have shown that petD undergoes a 10-fold higher rate of protein turnover when assembly is compromised, providing a quantitative readout for assembly efficiency .

  • Co-expression systems: Development of co-expression vectors for simultaneous production of multiple subunits to facilitate complex assembly.

  • Interaction mapping: Using crosslinking and mass spectrometry approaches to identify interaction interfaces between petD and other complex components.

Research in Lemna perpusilla has demonstrated that the Rieske Fe-S protein plays a key role in cytochrome b6f complex assembly, with its absence leading to reduced stability of other components, including subunit IV (petD) . This finding suggests that recombinant expression systems should consider co-expression of the Rieske protein to achieve proper complex assembly.

What techniques can be employed to study the interaction between petD and other subunits of the cytochrome b6f complex?

Multiple complementary techniques can elucidate the interaction network:

  • Co-immunoprecipitation (Co-IP): Using antibodies against tagged versions of petD or other subunits to pull down interacting partners.

  • Förster Resonance Energy Transfer (FRET): Labeling petD and potential interaction partners with appropriate fluorophore pairs to detect proximity-dependent energy transfer.

  • Surface Plasmon Resonance (SPR): Measuring binding kinetics and affinities between immobilized petD and other subunits in real-time.

  • Isothermal Titration Calorimetry (ITC): Quantifying thermodynamic parameters of binding interactions.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Identifying regions of petD involved in protein-protein interactions through differential solvent accessibility.

  • Cryo-Electron Microscopy: Visualizing the assembled complex structure at near-atomic resolution to define interaction interfaces.

  • Cross-linking Mass Spectrometry (XL-MS): Using chemical crosslinkers to capture transient interactions followed by mass spectrometric identification.

Implementation of these techniques has revealed that subunit IV (petD) interacts extensively with cytochrome b6 and contributes to the binding pocket for plastoquinone, highlighting its importance in both structural integrity and electron transport function.

How can researchers measure the impact of recombinant petD expression on photosynthetic electron transport?

Assessing the impact on photosynthetic electron transport requires both in vitro and in vivo approaches:

In vitro approaches:

  • Reconstituted proteoliposome assays: Measuring electron transfer rates in liposomes containing purified cytochrome b6f complex with recombinant petD.

  • Oxygen evolution/consumption measurements: Using Clark-type electrodes to quantify electron transport rates in the presence of artificial electron donors and acceptors.

  • Spectrophotometric assays: Monitoring the reduction and oxidation of cytochromes and other electron carriers in real-time.

In vivo approaches:

  • Complementation studies: Expressing recombinant petD in mutant lines deficient in native petD to assess functional restoration.

  • Chlorophyll fluorescence measurements: Quantifying PSII quantum yield, non-photochemical quenching, and electron transport rates in plants or algae expressing recombinant petD.

  • Growth and biomass analysis: Comparing growth parameters between wild-type plants and those expressing recombinant petD under various light conditions.

The following data parameters should be collected:

ParameterMeasurement MethodExpected Impact of Functional petD
Electron transport rateP700 reduction kineticsRestoration to >80% of wild-type levels
Cytochrome b6f activityPlastoquinol-plastocyanin oxidoreductase assayRestoration to >75% of wild-type levels
Photosystem II efficiencyFv/Fm chlorophyll fluorescenceMinimal direct impact (indirect effects possible)
Linear electron flowΔFlux through PSI and PSIIRestoration to ~85% of wild-type levels
Cyclic electron flowΔFlux around PSIRestoration to >70% of wild-type levels

What are the challenges in studying post-translational modifications of recombinant petD protein?

Studying post-translational modifications (PTMs) of recombinant petD presents several methodological challenges:

  • Expression system limitations: Bacterial expression systems like E. coli lack the cellular machinery for plant-specific PTMs, potentially producing recombinant petD with an inauthentic modification profile.

  • PTM preservation during purification: Many PTMs are labile and can be lost during harsh purification procedures, requiring gentle techniques and specific buffers with protease/phosphatase inhibitors.

  • Detection sensitivity: Some PTMs occur at sub-stoichiometric levels, requiring sensitive mass spectrometry techniques for detection.

  • Modification heterogeneity: The same protein can exist with different PTM patterns (proteoforms), complicating analysis.

  • Functional relevance: Establishing the physiological significance of identified PTMs requires additional experiments beyond their detection.

Addressing these challenges requires a multi-faceted approach:

  • Sample preparation optimization: Using gentler solubilization conditions and enrichment techniques specific to the PTM of interest.

  • Advanced mass spectrometry: Employing electron transfer dissociation (ETD) or electron capture dissociation (ECD) fragmentation methods that preserve labile PTMs during analysis.

  • Site-directed mutagenesis: Creating mutants at potential modification sites to assess functional impact.

  • Comparative analysis: Analyzing PTM profiles between native and recombinant petD to identify discrepancies.

  • In vitro modification: Utilizing purified modifying enzymes to reconstitute key PTMs on recombinant petD.

How can researchers address inclusion body formation when expressing recombinant petD in bacterial systems?

Inclusion body formation is a common challenge when expressing membrane proteins like petD. The following strategies can help address this issue:

  • Expression temperature optimization: Lowering the induction temperature to 16-20°C slows protein synthesis, potentially allowing more time for proper folding and membrane insertion.

  • Induction optimization: Using lower concentrations of inducer (0.1-0.2 mM IPTG rather than 1 mM) and extending induction time can reduce inclusion body formation.

  • Fusion partner utilization: N-terminal fusion with solubility-enhancing partners such as MBP (maltose binding protein), TrxA (thioredoxin), or SUMO can improve folding and solubility.

  • Co-expression with chaperones: Co-expressing molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) can assist in proper folding.

  • Specialized E. coli strains: Using strains specifically developed for membrane protein expression, such as C41(DE3) or C43(DE3), which are known to enhance membrane protein yield and reduce toxicity.

  • Refolding strategies: If inclusion bodies are unavoidable, optimized refolding protocols using gradual dialysis with appropriate detergents can be implemented.

The table below compares the efficiency of different approaches:

StrategySoluble Yield ImprovementComplexityTime Required
Temperature reduction (16°C)2-5 foldLowModerate
Reduced inducer concentration1.5-3 foldLowModerate
MBP fusion3-8 foldModerateModerate
Chaperone co-expression2-4 foldModerateModerate
C41/C43(DE3) strains3-10 foldLowLow
Inclusion body refoldingVariableHighHigh

What strategies can overcome poor expression or degradation of recombinant petD?

Several approaches can address poor expression or degradation issues:

  • Codon optimization: Analyzing and optimizing the codon usage of the Saccharum officinarum petD sequence for the expression host can significantly improve translation efficiency.

  • 5' and 3' UTR optimization: Modifying untranslated regions to enhance mRNA stability and translation initiation.

  • Protease deficient strains: Using E. coli strains deficient in specific proteases (e.g., BL21) to reduce degradation.

  • Protease inhibition: Including protease inhibitor cocktails during all purification steps.

  • Expression timing: Harvesting cells at optimal timepoints before significant degradation occurs. Studies show that cytochrome complex subunits can have differential turnover rates, with subunit IV (petD) showing up to 10-fold higher turnover rates under certain conditions .

  • Co-expression strategies: Expressing petD together with interacting partners to stabilize the protein through complex formation. Research on the cytochrome b6f complex suggests that the absence of Rieske Fe-S protein significantly affects the stability of other subunits, including subunit IV .

  • Stabilizing mutations: Introducing specific mutations that enhance protein stability without affecting function.

  • Expression vector optimization: Testing different promoters, signal sequences, and fusion partners to identify the optimal combination for expression.

The following data illustrates typical degradation patterns observed for recombinant membrane proteins like petD:

Time Post-InductionProtein Remaining (%) Standard ConditionsProtein Remaining (%) Optimized Conditions
1 hour100%100%
2 hours85%95%
4 hours60%85%
8 hours35%75%
20 hours10%55%

How can researchers design experiments to study the role of petD in supercomplexes formation?

Studying the role of petD in supercomplex formation requires sophisticated experimental approaches:

  • Blue Native PAGE (BN-PAGE): This non-denaturing electrophoresis technique preserves protein-protein interactions and allows visualization of intact supercomplexes containing cytochrome b6f.

  • Sucrose gradient ultracentrifugation: Separating supercomplexes based on size and density, followed by fraction analysis to identify components.

  • Chemical crosslinking coupled with mass spectrometry: Capturing transient interactions between cytochrome b6f and other photosynthetic complexes, with subsequent identification of interaction sites.

  • Cryo-electron tomography: Visualizing the spatial arrangement of photosynthetic complexes in their native membrane environment.

  • FRET-based proximity analysis: Using fluorescently labeled antibodies against different complex components to detect and quantify supercomplex formation.

  • Mutational analysis: Creating specific mutations in petD and analyzing their impact on supercomplex formation. Key experiments should include:

    • Deletion or mutation of specific domains

    • Substitution of residues at putative interaction interfaces

    • Creation of chimeric proteins using domains from different species

  • Comparative analysis across species: Examining supercomplex formation efficiency across different plant species with varying petD sequences to identify conserved interaction motifs.

The experimental design should include appropriate controls:

  • Wild-type petD as positive control

  • Known assembly-deficient mutants as negative controls

  • Gradient of expression levels to assess concentration-dependent effects

What approaches can be used to investigate the evolutionary conservation of petD across different photosynthetic organisms?

Investigating evolutionary conservation of petD requires integrated bioinformatic and experimental approaches:

  • Sequence-based analyses:

    • Multiple sequence alignment of petD from diverse photosynthetic organisms

    • Calculation of conservation scores for individual amino acid positions

    • Identification of conserved motifs and domains

    • Phylogenetic tree construction to trace evolutionary relationships

  • Structure-based analyses:

    • Homology modeling of petD proteins from different species

    • Structural alignment to identify conserved three-dimensional features

    • Mapping conservation scores onto structural models to identify functionally important regions

    • Molecular dynamics simulations to assess conservation of dynamic properties

  • Experimental validation:

    • Heterologous expression of petD from different species in a common host

    • Functional complementation studies in petD-deficient mutants

    • Chimeric protein construction with domains from different species to assess functional conservation

    • Site-directed mutagenesis of conserved residues to verify functional importance

  • Transcriptomics and proteomics:

    • Analysis of expression patterns across species under various conditions

    • Comparison of post-translational modifications across evolutionary diverse organisms

    • Correlation of expression patterns with ecological niches and photosynthetic strategies

The table below illustrates a typical conservation analysis of key functional domains in petD across representative photosynthetic organisms:

OrganismTaxonomic GroupTransmembrane Domain ConservationQuinone-binding Site ConservationInteraction Interface Conservation
Saccharum officinarumAngiospermsHigh (>85%)Very High (>95%)High (>80%)
Arabidopsis thalianaAngiospermsHigh (>85%)Very High (>95%)High (>85%)
Pinus taedaGymnospermsHigh (>80%)Very High (>90%)Moderate (>75%)
Marchantia polymorphaBryophytesModerate (>75%)High (>85%)Moderate (>70%)
Chlamydomonas reinhardtiiGreen algaeModerate (>70%)High (>85%)Low (>60%)
Synechocystis sp.CyanobacteriaLow (>55%)Moderate (>65%)Very Low (>40%)

What emerging technologies show promise for advancing research on recombinant Saccharum officinarum petD?

Several cutting-edge technologies are poised to transform research on recombinant petD:

  • Cell-free protein synthesis systems: Enabling rapid production of petD without cellular constraints, allowing for incorporation of non-canonical amino acids and bypassing toxicity issues.

  • Nanodiscs and lipid cubic phase crystallization: Providing better membrane mimetics for structural and functional studies of membrane-embedded petD.

  • Cryo-electron microscopy (Cryo-EM): Allowing visualization of cytochrome b6f complex with petD at near-atomic resolution without crystallization.

  • AlphaFold2 and related AI approaches: Predicting protein structures with unprecedented accuracy, enabling better understanding of petD structure and interactions.

  • CRISPR-Cas9 gene editing in chloroplasts: Facilitating precise modification of native petD in Saccharum officinarum for in vivo functional studies.

  • Single-molecule techniques: Including single-molecule FRET and force spectroscopy to study petD dynamics and interactions at the individual molecule level.

  • Microfluidics-based approaches: High-throughput screening of conditions for optimal expression, purification, and functional reconstitution.

  • Synthetic biology platforms: Creating minimal synthetic systems incorporating petD to understand its essential functional requirements.

Each of these technologies offers unique advantages for addressing specific challenges in petD research, from structural characterization to functional analysis and evolutionary studies.

How might research on recombinant petD contribute to understanding bioenergetic efficiency in sugarcane and other C4 plants?

Research on recombinant petD has significant implications for understanding and potentially enhancing bioenergetic efficiency in C4 plants like sugarcane:

  • C4 vs. C3 comparative analysis: Characterizing structural and functional differences in petD between C4 plants (like sugarcane) and C3 plants may reveal adaptations that contribute to the higher photosynthetic efficiency of C4 plants under high light and temperature conditions.

  • Bundle sheath vs. mesophyll specialization: Investigating potential differences in cytochrome b6f complexes between bundle sheath and mesophyll chloroplasts in C4 plants, which have specialized roles in the C4 carbon fixation pathway.

  • Electron transport optimization: Understanding the specific properties of sugarcane petD could reveal mechanisms for enhanced electron transport rates that support the high energetic demands of C4 photosynthesis.

  • Environmental adaptation: Analyzing how petD variants from different sugarcane cultivars adapted to varying environmental conditions might affect photosynthetic performance under stress.

  • Genetic engineering opportunities: Identifying key residues or domains in petD that could be targets for genetic modification to enhance photosynthetic efficiency or stress tolerance.

  • Metabolic modeling: Incorporating detailed kinetic data from recombinant petD studies into whole-plant metabolic models to predict the system-level impacts of alterations to cytochrome b6f function.

  • Crop improvement applications: Translating fundamental insights about petD function into breeding or engineering strategies for improved sugarcane varieties with enhanced yield potential or resilience.

Experimental approaches should include:

  • Comparing electron transport rates between recombinant cytochrome b6f complexes containing petD from C3 and C4 plants

  • Assessing the impact of environmental factors (light intensity, temperature, CO2 concentration) on complex function

  • Evaluating the interaction efficiency between cytochrome b6f and other components of the C4-specialized photosynthetic apparatus

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.