Recombinant Saccharum officinarum Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

The cytochrome b6/f complex mediates electron transfer between photosystems II and I, enabling ATP synthesis and NADPH production . Key functions:

  • Electron Transport: Facilitates plastoquinol oxidation and plastocyanin reduction, driving proton gradient formation .

  • Cyclic Electron Flow: Supports ATP synthesis independently of NADPH .

  • State Transitions: Adjusts energy distribution between PSI and PSII under varying light conditions .

In Saccharum officinarum, petB operates within a complex comprising subunits like PetD (subunit IV) and Rieske FeS protein .

A. Electron Transport Limitations

Studies in Nicotiana tabacum demonstrate that cytochrome b6/f content limits electron transport rates (ETR) more severely than ATP synthase, highlighting its role as a photosynthetic bottleneck .

B. Biotechnological Potential

  • Crop Improvement: Enhancing cytochrome b6/f content could boost photosynthetic efficiency under high CO₂ conditions, a strategy proposed for yield optimization .

  • Hybrid Complexes: Heterologous expression of cyanobacterial subunits (e.g., Porphyra Cyt c₆) has improved ETR in model plants, suggesting pathways for engineering sugarcane .

Challenges and Future Directions

  • Expression Optimization: Recombinant petB requires precise folding and heme incorporation, challenges in E. coli systems .

  • Functional Studies: Direct characterization of sugarcane petB in vivo remains limited, necessitating targeted proteomic and transcriptomic analyses .

Comparative Analysis of Recombinant Cytochrome b6 Variants

SpeciesExpression HostTagPurityApplicationSource
Prochlorothrix hollandicaE. coliHis-tag>90%SDS-PAGE, functional assays
Arabidopsis thalianaE. coliHis-tag>85%Structural studies
Saccharum officinarumE. coliHis-tag>85%Under investigation

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand that you may have specific requirements. To accommodate your needs, please indicate any format preferences when placing your order. We will do our best to fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize its development for your product.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Saccharum officinarum (Sugarcane)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a crucial component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b6 (petB) and what is its function in Saccharum officinarum?

Cytochrome b6 (petB) is a critical component of the cytochrome b6/f complex, which plays an essential role in the photosynthetic electron transport chain of higher plants, including Saccharum officinarum (sugarcane). This protein is encoded by the petB gene and functions as a b-type/c-type cytochrome containing three haem groups. The cytb6/f complex catalyzes the oxidation of quinols and the reduction of plastocyanin, establishing the proton force required for ATP synthesis . In sugarcane, as in other plants, this protein is crucial for energy metabolism and photosynthetic efficiency.

What methods are recommended for the expression of recombinant proteins in Saccharum species?

For recombinant protein expression in Saccharum species, researchers typically use prokaryotic expression systems as an initial approach. Based on methodologies used for other Saccharum proteins, the pET-30a vector system with Escherichia coli BL21 (DE3) cells has proven effective . The procedure involves:

  • Gene amplification using RT-PCR from Saccharum cDNA

  • Cloning into an intermediate vector (e.g., pMD18-T) for sequence verification

  • Subcloning into pET-30a using appropriate restriction sites (e.g., EcoRI and XhoI)

  • Transformation into E. coli BL21 (DE3) cells for protein expression

  • IPTG induction for protein production

  • Optimization of expression conditions to maximize soluble protein yield

It's important to note that recombinant proteins often form inclusion bodies in bacterial systems, requiring optimization of expression conditions including IPTG concentration, growth temperature, and induction time .

What are the common purification strategies for recombinant membrane proteins like Cytochrome b6?

Purification of recombinant membrane proteins like Cytochrome b6 typically involves:

  • Cell lysis using methods that preserve protein structure (sonication or French press)

  • Initial purification of inclusion bodies if the protein is insoluble

  • Solubilization using appropriate detergents

  • Affinity chromatography (commonly Ni-NTA for His-tagged proteins)

  • Refolding protocols if isolated from inclusion bodies

  • Dialysis to remove denaturants

  • Gel filtration for further purification

  • Concentration steps to obtain usable protein amounts

From research on other recombinant proteins in Saccharum, yields can vary significantly. For example, with SoP5CS protein, approximately 15 mg of purified protein was obtained from 1 liter of culture broth after refolding, dialysis, gel filtration, and concentration .

How can researchers verify the functional integrity of recombinant Cytochrome b6?

Verifying functional integrity of recombinant Cytochrome b6 requires multiple analytical approaches:

  • Spectroscopic analysis: Cytochrome b6 has characteristic absorption spectra due to its haem groups. Reduced versus oxidized spectra comparisons can confirm proper cofactor incorporation.

  • Western blotting: Using specific antibodies against Cytochrome b6. Commercial antibodies like polyclonal anti-Cyt b6/PetB raised against Arabidopsis thaliana with cross-reactivity to related species can be used at dilutions of 1:1000-1:5000 .

  • Blue native PAGE (BN-PAGE): This technique preserves protein complexes and can verify proper complex formation.

  • Activity assays: Measuring electron transport capability using artificial electron donors and acceptors.

For Western blot analysis, the following protocol has been validated for Cytochrome b6 detection:

  • Sample preparation with gentle denaturation (75°C for 5 min in Laemmli buffer)

  • Separation on 12% SDS-PAGE

  • Wet transfer to PVDF membrane (30 min)

  • Blocking with 5% milk (2h at room temperature)

  • Primary antibody incubation (1:1000 dilution, overnight at 4°C)

  • Secondary antibody (anti-rabbit IgG HRP conjugated, 1:25,000 dilution)

  • Detection with luminol-based chemiluminescence

What are the optimal expression conditions to minimize inclusion body formation for membrane proteins like Cytochrome b6?

Optimizing expression conditions for membrane proteins like Cytochrome b6 to minimize inclusion body formation includes:

  • Temperature modulation: Lower temperatures (16-20°C) often reduce inclusion body formation compared to standard 37°C incubation.

  • Inducer concentration: Using lower IPTG concentrations (0.1-0.5 mM) instead of the standard 1 mM can promote proper folding.

  • Expression time: Shorter induction periods may yield less protein but in more soluble form.

  • Co-expression with chaperones: Expression vectors carrying molecular chaperones can improve protein folding.

  • Use of fusion tags: Solubility-enhancing tags like MBP (maltose-binding protein) or SUMO can improve folding.

Despite these optimizations, many membrane proteins like Cytochrome b6 may still form inclusion bodies. In such cases, proper refolding protocols become critical. Research on other Saccharum proteins indicates that despite efforts to optimize expression conditions, recombinant proteins may still accumulate as inclusion bodies, necessitating effective refolding strategies .

What strategies can be employed to improve the yield of functional recombinant Cytochrome b6?

Strategies to improve functional recombinant Cytochrome b6 yield include:

StrategyMethodologyExpected Outcome
Vector optimizationUse of specialized vectors with regulated promotersBetter control over expression rate
Host strain selectionTesting multiple E. coli strains (Rosetta, Origami, C41/C43)Improved membrane protein expression
Culture media optimizationRich media (TB, 2XYT) vs. minimal mediaIncreased biomass and protein yield
Inducer typeIPTG alternatives (lactose, arabinose)Gentler induction, better folding
Co-factors additionAddition of δ-aminolevulinic acid to mediaEnhanced haem synthesis and incorporation
Scale-up approachFed-batch fermentation vs. shake flaskHigher cell density and protein yield

Research has shown that for membrane proteins like Cytochrome b6, a combination of these approaches may be necessary, with expected yields ranging from 1-15 mg/L depending on optimization success .

How should researchers interpret differences between expected and observed molecular weights of recombinant Cytochrome b6?

When analyzing recombinant Cytochrome b6, the expected molecular weight is approximately 24 kDa . Discrepancies between expected and observed molecular weights could indicate:

  • Post-translational modifications: Presence or absence of expected modifications

  • Incomplete denaturation: Membrane proteins may not fully denature in SDS, causing aberrant migration

  • Proteolytic degradation: Resulting in smaller fragments

  • Fusion tag effects: His-tags or other fusion elements altering migration patterns

  • Strong detergent binding: Membrane proteins may retain bound detergent molecules

Analysis approach:

  • Always include appropriate molecular weight markers

  • Compare migration patterns in different gel systems (Tricine vs. glycine-based)

  • Consider mass spectrometry analysis for accurate mass determination

  • Use epitope-specific antibodies to identify specific regions of the protein

What controls should be included when validating antibodies against recombinant Cytochrome b6?

When validating antibodies for Cytochrome b6 detection, the following controls are essential:

  • Positive control: Purified recombinant Cytochrome b6 protein

  • Negative control:

    • Extracts from organisms lacking the target or with the gene knocked out

    • Pre-immune serum for custom antibodies

  • Cross-reactivity assessment: Testing against related species (e.g., comparing reactivity in Saccharum to known reactivity in Zea mays)

  • Peptide competition: Pre-incubating antibody with immunizing peptide to confirm specificity

  • Loading controls: Using antibodies against housekeeping proteins

For Cytochrome b6 specifically, antibodies raised against conserved regions show cross-reactivity across multiple plant species including Arabidopsis thaliana, Chlamydomonas reinhardtii, and Zea mays , suggesting they may work effectively with Saccharum officinarum samples as well.

What are effective protein extraction methods for preserving Cytochrome b6 integrity from plant tissues?

For extracting Cytochrome b6 from Saccharum while maintaining protein integrity, consider these validated approaches:

  • Thylakoid membrane isolation buffer:

    • 0.4 M sorbitol

    • 50 mM HEPES-NaOH (pH 7.8)

    • 10 mM NaCl

    • 5 mM MgCl₂

    • 2 mM EDTA

  • Critical steps for membrane protein preservation:

    • Maintain cold temperatures throughout extraction (4°C)

    • Include protease inhibitors (PMSF, cocktail inhibitors)

    • Use gentle homogenization methods to prevent denaturation

    • Avoid excessive detergent concentrations that may denature the protein

    • Consider non-ionic detergents (DDM, Triton X-100) for solubilization

  • Fractionation approach: Separate thylakoid membranes before solubilization to reduce contamination with other cellular components.

What methods are recommended for analyzing the impact of environmental stresses on Cytochrome b6 expression and function?

For analyzing environmental stress impacts on Cytochrome b6 expression and function:

  • Stress treatment design:

    • Apply controlled stress conditions (drought, salt, temperature)

    • Include time-course sampling to capture dynamic responses

    • Establish clear control conditions for comparison

  • Physiological measurements that should accompany expression analysis:

    • Chlorophyll content (SPAD measurements)

    • Relative water content (RWC)

    • Membrane damage (MDA content)

    • Antioxidant enzyme activities (SOD, CAT)

    • Photosynthetic efficiency (chlorophyll fluorescence)

  • Expression analysis methods:

    • RT-qPCR for transcript levels

    • Western blot with specific antibodies

    • Protein activity assays

    • Blue native PAGE for complex assembly analysis

  • Data analysis approach: Analysis should incorporate statistical tools (ANOVA, Duncan's test) with significance levels at P≤0.05 and P≤0.01, following approaches used in other Saccharum protein studies .

How can researchers distinguish between native and recombinant Cytochrome b6 in experimental systems?

Distinguishing between native and recombinant Cytochrome b6 in experimental systems can be achieved through:

  • Fusion tags: Incorporating His, FLAG, or other tags to the recombinant protein allows specific detection using tag-specific antibodies.

  • Molecular weight differences: Recombinant proteins with tags will show slightly higher molecular weights (expected native MW is 24 kDa for Cytochrome b6) .

  • Epitope mapping: Using antibodies targeting regions that differ between native and recombinant versions.

  • Mass spectrometry: Identifying specific peptides unique to the recombinant version.

  • Expression systems: Using heterologous systems where the native protein is absent or has significant sequence differences.

  • Immunodepletion: Selectively removing native or recombinant forms using specific antibodies.

For Western blotting verification of recombinant Cytochrome b6, researchers can use protocol parameters established for this protein class, including gentle denaturation conditions (75°C for 5 min) and wet transfer methods to optimize detection sensitivity .

How can structural studies of recombinant Cytochrome b6 contribute to understanding photosynthetic efficiency in Saccharum officinarum?

Structural studies of recombinant Cytochrome b6 can provide valuable insights into photosynthetic efficiency in Saccharum officinarum through:

  • Structure-function relationships: Correlating specific structural features with electron transport efficiency.

  • Comparison with model species: Analyzing structural differences between Saccharum Cytochrome b6 and well-characterized versions from model plants like Arabidopsis thaliana.

  • Mutation analysis: Creating site-directed mutants to identify critical residues for function.

  • Protein-protein interaction surfaces: Mapping interaction regions with other components of the photosynthetic machinery.

  • Environmental response mechanisms: Identifying structural changes under stress conditions that may affect photosynthetic performance.

Methodological approaches should include X-ray crystallography, cryo-electron microscopy, or NMR studies of the purified recombinant protein, with functional validation through complementation studies in model systems.

What are the best methods for analyzing electron transport chain efficiency using recombinant Cytochrome b6?

Analyzing electron transport chain efficiency using recombinant Cytochrome b6 requires specialized approaches:

  • Reconstitution systems: Incorporating purified recombinant Cytochrome b6 into liposomes with other electron transport components.

  • Spectroscopic methods:

    • Measuring cytochrome redox states through absorbance changes

    • Following electron transfer kinetics using stopped-flow techniques

    • Monitoring electrochromic shift measurements to assess proton gradient formation

  • Oxygen evolution/consumption: Measuring oxygen evolution rates in reconstituted systems.

  • Cytochrome b6/f activity assays: Using artificial electron donors and acceptors to measure specific activity of the complex.

  • Chlorophyll fluorescence analysis: When incorporated into thylakoid membranes, changes in chlorophyll fluorescence parameters can indicate electron transport efficiency.

These approaches can provide quantitative data on the functional efficiency of recombinant Cytochrome b6 compared to the native protein.

How can genetic engineering of Cytochrome b6 be used to improve photosynthetic efficiency in Saccharum officinarum?

Genetic engineering of Cytochrome b6 for improved photosynthetic efficiency in Saccharum officinarum could include:

  • Targeted mutations: Introducing specific amino acid changes to enhance electron transfer rates or reduce sensitivity to inhibitors.

  • Overexpression strategies: Increasing Cytochrome b6 levels to potentially overcome rate-limiting steps in electron transport.

  • Promoter modifications: Engineering expression patterns to better align with environmental conditions.

  • Chimeric proteins: Creating fusion proteins with components from more efficient species.

  • Stress-tolerant variants: Engineering versions with improved function under specific stress conditions relevant to sugarcane cultivation.

For transformation and expression in Saccharum, researchers would need to adapt established methods for recombinant protein expression in plants, potentially using Agrobacterium-mediated transformation followed by regeneration of transgenic plants and phenotypic/molecular characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.