Recombinant Saccharum officinarum NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Saccharum officinarum NAD(P)H-quinone Oxidoreductase Subunit 3, Chloroplastic (ndhC)

Saccharum officinarum NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is a protein found in sugarcane (Saccharum officinarum) that belongs to the NAD(P)H-quinone oxidoreductase family . These enzymes catalyze the two-electron reduction of quinones and a variety of other compounds, utilizing either NADH or NADPH as cofactors . The ndhC subunit is a component of the chloroplast NDH complex, which is involved in electron transfer in the photosynthetic chain .

Key Features and Characteristics

  • Species: Saccharum officinarum (Sugarcane)

  • Protein Names: NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic; NAD(P)H dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3

  • Gene Name: ndhC

  • Sequence Information: The full-length protein sequence is available .

  • Molecular Weight: The theoretical molecular weight of a related protein, NAD(P)H-quinone oxidoreductase subunit K, chloroplastic, from Hordeum vulgare subsp. spontaneum (wild barley), is approximately 27.569 kDa .

  • Function: It functions in the transfer of electrons from NAD(P)H to quinones in the photosynthetic chain .

Function and Mechanism

NAD(P)H-quinone oxidoreductases, including ndhC, catalyze the reduction of quinones, which are important for various cellular processes, including detoxification and antioxidant defense . These enzymes generally facilitate two-electron reductions, which, in the case of quinones, prevent the formation of reactive semiquinones .

The Saccharum officinarum ndhC is located in the chloroplast, where it participates in the NDH complex . The NDH complex mediates electron transfer from NAD(P)H to plastoquinone, a crucial component of the photosynthetic electron transport chain . This process is important for regulating the redox state of the plastoquinone pool and for protecting the photosynthetic apparatus from damage .

Role in Plants

In plants, NAD(P)H-quinone oxidoreductases play a crucial role in:

  • Photosynthesis: Facilitating electron transfer within the chloroplast .

  • Redox Balance: Maintaining the balance of reduction and oxidation in the chloroplast, which is essential for optimal photosynthetic efficiency and preventing oxidative stress .

  • Prenylquinone Metabolism: Contributing to the synthesis and regulation of prenylquinones like plastoquinone, phylloquinone (vitamin K1), and tocopherol (vitamin E) .

Related Research

Other research has highlighted the roles of NAD(P)H-quinone oxidoreductases in various organisms and contexts:

  • Role in Disease: NAD(P)H:quinone Oxidoreductase 1 (NQO1) exerts antioxidant and anti-inflammatory activities .

  • Structural Studies: The crystal structure of the Escherichia coli YieF protein, an NDH-2, has been determined, providing insights into the structural features of these enzymes .

  • NDH Subunits: Ten plant chloroplast-specific NDH subunits and their interactions with other subunits in NDH have been elucidated .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Saccharum officinarum (Sugarcane)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWTFLIIASLIPILVFWISGLLAPVSEGPEKLSSYESGIEPMGGAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILVVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially in a chloroplast respiratory chain. In this organism, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic location of ndhC in the Saccharum officinarum chloroplast genome?

The ndhC gene is located in the Large Single Copy (LSC) region of the Saccharum officinarum chloroplast genome. Comparative analyses of the chloroplast genomes in Saccharum species have shown that ndhC is positioned in a region that exhibits notable sequence variations, specifically in the intergenic region "ndhC-trnV-UAC" which has been found to contain 7 SNPs when comparing different Saccharum species . The complete chloroplast genome of S. officinarum is approximately 141,182-141,183 bp in length with the LSC region spanning about 83,047 bp .

What is the functional role of ndhC in sugarcane chloroplasts?

The ndhC gene encodes a subunit of the NAD(P)H dehydrogenase complex (NDH complex) in the chloroplast, which is involved in cyclic electron flow around photosystem I. This complex plays a crucial role in photosynthesis, particularly under environmental stress conditions. In Saccharum species, the ndhC protein contributes to proton gradient formation across the thylakoid membrane and subsequently to ATP synthesis. The gene belongs to a family of genes coding for subunits of NADH-dehydrogenase (including ndhF and ndhD), which are essential components of chloroplast electron transport systems . Functional analyses have shown that the NDH complex enhances photosynthetic efficiency under fluctuating light conditions and contributes to plant adaptation to various environmental stresses.

How evolutionarily conserved is ndhC across Saccharum species?

Comparative genomic analyses have shown that ndhC exhibits moderate sequence conservation across Saccharum species, with some notable variations. The nucleotide diversity (Pi) analyses based on sliding window analysis showed that ndhC is part of a region that displays higher variability compared to other chloroplast genes. Specifically, the "ndhC-trnV-UAC" intergenic region has been identified as a variant hotspot with significant divergence across Saccharum species . Studies comparing S. officinarum and S. spontaneum, the two main ancestors of modern sugarcane hybrids, revealed genetic distances for protein-coding genes ranging from 0.00000 to 0.00288, with ndhC showing moderate variability under purifying selection pressure .

What are the most effective methods for isolating intact chloroplast DNA from Saccharum species for ndhC analysis?

For optimal isolation of chloroplast DNA from Saccharum species, researchers should employ a modified CTAB (Cetyltrimethylammonium Bromide) method with EDTA buffer addition. Based on protocols used in similar studies of chloroplast genomes, the recommended approach includes:

  • Preparation of fresh, young leaf tissue (preferably 5-10g)

  • Addition of EDTA buffer (1.0 mol/L Tris-HCl (pH 8.0), 0.5 mol/L EDTA-Na₂, 5.0 mol/L NaCl) prior to CTAB solution treatment

  • Treatment with CTAB solution (1.0 mol/L Tris-HCl (pH 8.0), 0.5 mol/L EDTA-Na₂, 2% CTAB)

  • Differential centrifugation to isolate intact chloroplasts

  • DNA extraction from purified chloroplasts

This approach significantly reduces nuclear DNA contamination and provides high-quality chloroplast DNA suitable for whole genome sequencing, targeted PCR amplification of ndhC, or other molecular analyses . Following extraction, library preparation with 350 bp insert size fragments using standard TruSeq DNA sample preparation kits is recommended for next-generation sequencing approaches.

What experimental design approach is most appropriate for recombinant expression of Saccharum officinarum ndhC?

A multivariant experimental design approach is recommended for optimizing recombinant expression of Saccharum officinarum ndhC. Based on established methodologies for recombinant protein expression in E. coli, a fractional factorial screening design should be implemented to simultaneously evaluate multiple variables affecting expression . Key parameters to optimize include:

ParameterRecommended Range for Optimization
IPTG concentration0.1-1.0 mM
Induction temperature16-37°C
Induction time4-6 hours
Media compositionLB, TB, 2YT
Host strainBL21(DE3), Rosetta, Arctic Express
Codon optimizationNative vs. optimized sequence
Vector typepET vs. pGEX vs. custom

This approach allows for the identification of statistically significant variables and their interactions, enabling the development of an optimized expression protocol with fewer experiments than traditional univariant methods. Special attention should be paid to codon optimization for E. coli expression, as Saccharum genes often contain rare codons that can impede efficient translation .

How can researchers develop a reliable assay for measuring the enzymatic activity of recombinant ndhC?

Developing a reliable enzymatic assay for recombinant ndhC requires consideration of its role within the multi-subunit NAD(P)H dehydrogenase complex. Since ndhC functions as part of a larger complex, the following methodological approach is recommended:

  • Co-expression of ndhC with other essential NDH complex subunits (minimally ndhB and ndhK) to form a functional sub-complex

  • Purification using affinity tags (polyhistidine tag is preferable) under non-denaturing conditions

  • Activity measurement using artificial electron acceptors such as:

    • 2,6-dichloroindophenol (DCIP)

    • Menadione (two-electron acceptor)

    • Ferricyanide

The spectrophotometric assay should monitor the reduction of these electron acceptors at appropriate wavelengths (600 nm for DCIP). Kinetic parameters (Km and Vmax) can be determined using Michaelis-Menten and Lineweaver-Burk plots . For accurate activity assessment, the reaction mixture should contain 50 mM Tris-HCl (pH 7.5), 100 μM NADPH or NADH, varying concentrations of electron acceptors, and the purified enzyme at 25°C. This methodology has been effectively used to characterize NADPH:quinone oxidoreductase activity in other systems and can be adapted for the Saccharum ndhC-containing complex .

How can researchers analyze SNPs in the ndhC gene across different Saccharum species?

To analyze SNPs in the ndhC gene across different Saccharum species, researchers should implement a comprehensive approach that integrates whole chloroplast genome sequencing with targeted validation. Based on established methodologies, the following protocol is recommended:

  • Whole Genome Sequencing Approach:

    • Perform whole chloroplast genome sequencing of multiple accessions (at least 5-10) from each Saccharum species

    • Use at least 4.5 GB of clean data per sample with 150 bp paired-end reads

    • Assemble complete chloroplast genomes and align the ndhC regions

  • SNP Identification and Validation:

    • Use multiple SNP detection algorithms (GATK, FreeBayes, and Samtools) and consider only SNPs identified by at least two methods

    • Validate species-specific SNPs using PCR amplification and Sanger sequencing

  • dCAPS Marker Development:

    • Design derived Cleaved Amplified Polymorphic Sequence (dCAPS) markers for SNP validation

    • For each SNP, develop primers that incorporate a mismatch to create a restriction enzyme recognition site

    • Test markers on a diverse panel of Saccharum germplasm

From previous studies, researchers identified significant SNPs in the ndhC-trnV-UAC intergenic region with 7 variants between species . These SNPs can be developed into diagnostic markers for species identification within the Saccharum complex, similar to the approach used for markers such as Sscpd1 and Sscpd2 that were developed for distinguishing S. officinarum from S. robustum .

What evolutionary forces have shaped the sequence variation in ndhC across the Saccharum complex?

Analysis of evolutionary forces shaping ndhC sequence variation in the Saccharum complex has revealed a complex interplay of purifying selection, functional constraints, and genomic rearrangements. Multiple lines of evidence suggest:

  • Purifying Selection: Calculation of dN/dS ratios across Saccharum species indicates that ndhC, like most photosynthesis-related genes, is under moderate to strong purifying selection. The calculated dN/dS ratios for chloroplast genes across Saccharum species average around 0.24-0.25, with genes encoding NADH-dehydrogenase subunits specifically exhibiting values consistent with purifying selection . This evolutionary pattern is consistent with the functional importance of the NDH complex in photosynthesis.

  • Chromosomal Rearrangements: The genomic regions containing ndhC have been affected by chromosome rearrangements during Saccharum evolution. Research has shown that 80% of nucleotide binding site-encoding genes associated with disease resistance are located in rearranged chromosomal regions in S. spontaneum . While ndhC is not directly involved in disease resistance, these rearrangements have influenced diversity patterns across the genome.

  • Balancing Selection in Specific Regions: Studies have identified balancing selection in rearranged regions of the Saccharum genome, with higher genetic diversity (π = 0.00025 ± 0.00003) compared to non-rearranged regions (π = 0.00021 ± 0.00001, P = 0.000234) . These patterns have potentially influenced the diversity observed in ndhC and surrounding regions.

The chloroplast genome's basic chromosome number reduction from 10 to 8 in S. spontaneum was caused by fissions of ancestral chromosomes followed by translocations, creating a complex evolutionary history that has shaped the current diversity patterns in genes like ndhC .

How can phylogenetic analysis of ndhC contribute to understanding Saccharum species relationships?

Phylogenetic analysis of ndhC can provide valuable insights into Saccharum species relationships, particularly when integrated with whole chloroplast genome data. The methodological approach should include:

  • Sequence Selection and Alignment:

    • Extract ndhC coding sequences from assembled chloroplast genomes of multiple Saccharum species and related genera

    • Include representatives of S. officinarum, S. spontaneum, S. robustum, S. sinense, S. barberi, and related genera such as Tripidium (Erianthus), Narenga, and Miscanthus

    • Use outgroups from the Poaceae family (Sorghum bicolor and Zea mays)

    • Perform multiple sequence alignment using MAFFT with G-INS-i algorithm

  • Phylogenetic Analysis:

    • Implement both Maximum Likelihood (RAxML or IQ-TREE) and Bayesian Inference (MrBayes) approaches

    • Use appropriate nucleotide substitution models selected by ModelTest

    • Assess node support with bootstrap values (>1000 replicates) and posterior probabilities

Previous phylogenetic analyses based on chloroplast protein-coding genes have demonstrated that S. officinarum and S. robustum share a common ancestor, while S. sinense and S. barberi have more ancient cytoplasmic origins . Specifically, studies comparing substitution rates across the Saccharum complex showed that S. officinarum has lower dN values (0.0030±0.0007) compared to E. arundinaceus (0.0039±0.0010) and S. spontaneum (similar to M. sinensis at 0.0036±0.0010) . These analyses support the hypothesis that S. officinarum is more closely related to Miscanthus than to Erianthus, providing a framework for understanding the complex evolutionary history of Saccharum.

What are the optimal conditions for heterologous expression of Saccharum officinarum ndhC in E. coli systems?

Based on systematic studies of recombinant protein expression, the optimal conditions for heterologous expression of Saccharum officinarum ndhC in E. coli systems should be carefully controlled across multiple parameters. The recommended conditions are:

ParameterOptimal ConditionJustification
Expression vectorpET-28a with N-terminal His-tagFacilitates detection and purification while minimizing interference with protein folding
E. coli strainBL21(DE3) RosettaContains extra tRNAs for rare codons common in plant genes
Growth mediumTerrific Broth (TB)Provides better buffering capacity and nutrient availability
Induction temperature18-20°CLower temperatures reduce inclusion body formation for membrane proteins
IPTG concentration0.1-0.2 mMLower concentrations favor slower, more correct protein folding
Induction time16-18 hoursExtended time at lower temperature maximizes soluble expression
Cell lysis buffer50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 0.5% DDMDetergent helps solubilize membrane-associated proteins

Additionally, co-expression with molecular chaperones (GroEL/GroES) has been shown to significantly enhance the soluble expression of complex membrane proteins like ndhC . The experimental design should include a fractional factorial screening approach to fine-tune these conditions, as the optimal parameters may vary slightly depending on the specific construct design and expression goals.

What strategies can improve the solubility and stability of recombinant ndhC protein?

Improving solubility and stability of recombinant ndhC protein requires a multi-faceted approach addressing the membrane-associated nature of this protein. Based on studies of similar proteins, the following strategies are recommended:

  • Fusion Partner Selection:

    • Use solubility-enhancing fusion partners such as MBP (Maltose Binding Protein), SUMO, or Thioredoxin

    • Include a cleavable linker (TEV protease site) for tag removal after purification

    • Position the tag at the N-terminus to avoid interfering with C-terminal membrane association

  • Protein Engineering Approaches:

    • Remove predicted transmembrane domains or hydrophobic regions if not essential for activity

    • Introduce targeted mutations to enhance stability based on homology modeling

    • Consider expressing functional domains rather than the full-length protein

  • Buffer Optimization During Purification:

    • Include appropriate detergents (0.03-0.1% DDM or 0.5-1% CHAPS)

    • Add stabilizing agents such as glycerol (10-20%)

    • Test various pH conditions (pH 6.5-8.0) and salt concentrations (150-500 mM NaCl)

    • Include reducing agents (5 mM β-mercaptoethanol or 1 mM DTT)

  • Storage Conditions:

    • Add protective osmolytes (trehalose or sucrose at 5-10%)

    • Store at higher protein concentrations (>1 mg/ml)

    • Flash-freeze in liquid nitrogen for long-term storage

These approaches have been successfully applied to other membrane-associated proteins and components of electron transport chains, resulting in significantly improved solubility and stability profiles . When implementing these strategies, it's advisable to use a combinatorial approach, as the effects of different solubility-enhancing techniques are often synergistic.

How can researchers effectively measure the interaction between recombinant ndhC and other subunits of the NAD(P)H dehydrogenase complex?

To effectively measure the interaction between recombinant ndhC and other subunits of the NAD(P)H dehydrogenase complex, researchers should employ multiple complementary approaches that capture different aspects of protein-protein interactions. The following methodological framework is recommended:

  • Co-Immunoprecipitation Studies:

    • Express epitope-tagged versions of ndhC and potential interacting partners (ndhB, ndhK, etc.)

    • Perform pull-down assays using anti-tag antibodies

    • Analyze co-precipitated proteins by western blotting and mass spectrometry

  • Heterodimer Approach:

    • Generate a heterodimer system similar to that used for NAD(P)H:quinone oxidoreductase studies

    • Express wild-type and mutant versions of interacting subunits with polyhistidine tags for purification

    • Purify the heterodimeric complexes using nickel-nitrilotriacetate columns under non-denaturing conditions

    • Analyze composition by SDS and non-denaturing polyacrylamide gel electrophoresis

  • Functional Assays to Assess Interaction Quality:

    • Measure enzyme kinetics using two-electron acceptors like 2,6-dichloroindophenol and menadione

    • Compare kinetic parameters (Km and kcat) between wild-type homodimers and heterodimers

    • Assess changes in substrate specificity as indicators of structural alterations

  • Biophysical Interaction Analysis:

    • Use surface plasmon resonance (SPR) to measure binding kinetics

    • Employ isothermal titration calorimetry (ITC) to determine thermodynamic parameters

    • Implement microscale thermophoresis (MST) for interaction studies in near-native conditions

This multi-method approach provides robust evidence of protein-protein interactions and their functional consequences. From previous studies of similar systems, it's been established that subunits of oxidoreductase complexes can function independently with two-electron acceptors but dependently with four-electron acceptors, highlighting the importance of studying these interactions under various substrate conditions .

How can the manipulation of ndhC expression influence photosynthetic efficiency in sugarcane?

Manipulating ndhC expression can significantly impact photosynthetic efficiency in sugarcane, particularly under stress conditions. As a component of the NDH complex involved in cyclic electron flow, ndhC plays a crucial role in balancing energy distribution between photosystems. Based on current understanding of NDH complex function, the following approaches can be implemented:

  • Overexpression Strategy:

    • Utilizing a combinatorial stacked promoter system with both constitutive and tissue-specific promoters

    • Recommended promoters include the maize ubiquitin 1 promoter (pUbi), sugarcane dirigent16 (pSHDIR16), and sugarcane proline-rich protein (pSHPRP) promoters

    • This approach has shown success in achieving up to 11.5% of total soluble protein expression for recombinant proteins in sugarcane

  • Predicted Physiological Outcomes:

    • Enhanced cyclic electron flow around photosystem I

    • Improved ATP/NADPH ratio balancing

    • Better photosynthetic performance under fluctuating light conditions

    • Increased non-photochemical quenching capacity

    • Greater tolerance to drought, high light, and temperature stresses

  • Measurement of Effects:

    • Chlorophyll fluorescence parameters (Fv/Fm, NPQ, ETR) using PAM fluorometry

    • Gas exchange measurements (CO₂ assimilation, transpiration, WUE)

    • Growth analysis under normal and stress conditions

    • Yield components under field conditions

Studies on NDH complex function in other plant species suggest that optimized expression of ndhC could provide a 10-15% increase in photosynthetic efficiency under fluctuating light conditions and a 20-30% improvement in photosynthetic recovery after drought stress . This approach represents a promising strategy for improving sugarcane productivity in challenging environmental conditions.

What methodologies are most appropriate for studying ndhC mutations and their phenotypic effects in sugarcane?

Given the polyploid nature of sugarcane and the technical challenges of conventional genetic manipulation, multiple complementary approaches are necessary to study ndhC mutations and their phenotypic effects:

  • CRISPR/Cas9 Genome Editing:

    • Design sgRNAs targeting conserved regions of ndhC across homeologs

    • Optimize transformation protocols using biolistic methods for sugarcane

    • Screen transformants using high-throughput sequencing to identify mutations

    • Generate plants with varying mutation loads to create an allelic series

  • RNA Interference (RNAi) Approach:

    • Design RNAi constructs targeting conserved regions of ndhC transcripts

    • Use the combinatorial promoter stacking system for effective expression

    • Validate knockdown efficiency through RT-qPCR analysis

    • Compare phenotypes across independent events with varying knockdown levels

  • Phenotypic Characterization Methods:

    • High-throughput chlorophyll fluorescence imaging

    • Gas exchange measurements under controlled environmental conditions

    • Electron transport rate measurements using spectroscopic techniques

    • Metabolomics profiling focusing on energy-related metabolites

    • Stress response analysis (drought, high light, temperature extremes)

  • Multi-Omics Integration:

    • Transcriptomics to identify compensatory changes in gene expression

    • Proteomics to assess NDH complex assembly and stability

    • Metabolomics to evaluate impact on photosynthetic efficiency

These methodologies should be implemented using appropriate experimental designs, such as randomized complete block designs with sufficient replication (4-6 replicates) to account for sugarcane's inherent variability . Field trials should include multiple locations and growing seasons to assess genotype × environment interactions.

How can comparative genomic approaches inform the engineering of improved ndhC variants for enhanced stress tolerance?

Comparative genomic approaches provide a powerful framework for identifying naturally occurring ndhC variants with enhanced functionality that can be incorporated into sugarcane improvement programs. Based on existing research, the following methodology is recommended:

  • Comprehensive Sequence Analysis:

    • Sequence ndhC from diverse germplasm including:

      • Wild Saccharum species (S. spontaneum accessions from diverse environments)

      • Related genera (Miscanthus, Erianthus, Narenga)

      • Ancient cultivars (S. sinense, S. barberi)

      • Modern hybrids

    • Identify naturally occurring allelic variants with potential adaptive significance

    • Focus on variants in species adapted to extreme environments

  • Structure-Function Analysis:

    • Map variants onto predicted protein structures using homology modeling

    • Identify variants in functional domains or at subunit interfaces

    • Predict impact on protein stability, complex assembly, and catalytic activity

  • Evolutionary and Selection Analysis:

    • Calculate selective pressure metrics (dN/dS) across lineages

    • Identify sites under positive selection that may confer adaptive advantages

    • Compare substitution rates between species adapted to different environments

Data from comparative studies of Saccharum chloroplast genomes have revealed significant variation in ndhC and related genes, with nucleotide diversity (Pi) values indicating potential sites of adaptive significance . Particularly, the ndhC-trnV-UAC region has been identified as a variant hotspot with 7 SNPs between species .

The integration of these comparative genomic approaches can guide precision engineering of ndhC variants with enhanced functionality. The resulting improved variants can be introduced into elite sugarcane germplasm using the established expression systems that have achieved high-level recombinant protein accumulation (up to 11.5% of total soluble protein) , potentially enhancing photosynthetic efficiency and stress tolerance in commercial sugarcane varieties.

What spectroscopic methods are most effective for characterizing the functional properties of recombinant ndhC?

For comprehensive characterization of recombinant ndhC functional properties, a multi-spectroscopic approach targeting different aspects of protein structure and activity is recommended:

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Provides information on electron transfer cofactors and redox states

    • Detects formation of radical species during catalytic cycles

    • Monitors changes in the environment of iron-sulfur clusters

    • Requires sample preparation under anaerobic conditions and low temperatures (77K or below)

  • UV-Visible Absorption Spectroscopy:

    • Tracks redox changes in NAD(P)H (340 nm) during enzyme activity

    • Monitors reduction of artificial electron acceptors:

      • 2,6-dichloroindophenol (600 nm)

      • Menadione (using secondary indicators)

      • Ferricyanide (420 nm)

    • Enables real-time kinetic measurements for determining Km and kcat values

  • Circular Dichroism (CD) Spectroscopy:

    • Assesses secondary structure composition and integrity

    • Monitors thermal stability and unfolding profiles

    • Detects conformational changes upon substrate binding

    • Far-UV CD (190-250 nm) for secondary structure

    • Near-UV CD (250-350 nm) for tertiary structure fingerprint

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • 1H NMR can monitor substrate conversion in real-time

    • Allows direct visualization of reaction progress (Figure 1):
      ![Figure 1: Example of NMR spectra showing reaction progress over time, with substrate depletion and product formation visible at characteristic chemical shifts]

    • Enables construction of Michaelis-Menten and Lineweaver-Burk plots directly from spectral data

    • Provides information on reaction rates and equilibrium constants

For optimal results, these methods should be complemented with enzyme kinetics studies under varying pH, temperature, and ionic strength conditions. Near-infrared (NIR) spectroscopy, which has been successfully applied to analyze sugarcane quality parameters , may also be adapted for high-throughput screening of recombinant ndhC activity in various genetic backgrounds or under different environmental conditions.

How can researchers distinguish between the functions of different ndhC alleles in polyploid sugarcane?

Distinguishing between the functions of different ndhC alleles in polyploid sugarcane requires a sophisticated experimental approach that combines allele-specific expression analysis with protein characterization. Based on successful strategies employed in similar complex systems, the following methodology is recommended:

  • Allele-Specific Expression Analysis:

    • Design allele-specific primers targeting SNP sites identified through whole chloroplast genome sequencing

    • Implement RT-qPCR to quantify the expression levels of distinct alleles

    • Use RNA-Seq with computational tools for haplotype phasing to determine allele-specific expression patterns

    • Validate findings using allele-specific probes and digital droplet PCR for absolute quantification

  • Heterologous Expression of Individual Alleles:

    • Clone and express each ndhC allele separately in E. coli or yeast expression systems

    • Purify recombinant proteins using affinity chromatography

    • Perform comparative biochemical characterization of each allelic variant:

      • Enzyme kinetics (Km, Vmax, kcat)

      • Substrate specificity profiles

      • pH and temperature optima

      • Stability measurements

  • In vivo Functional Complementation:

    • Transform model plants (Arabidopsis ndhC mutants) with individual sugarcane ndhC alleles

    • Assess the degree of functional complementation through:

      • Photosynthetic parameters (chlorophyll fluorescence, P700 oxidation)

      • Growth phenotypes under normal and stress conditions

      • Complex formation and stability analysis

  • Allele-Specific CRISPR Targeting:

    • Design CRISPR/Cas9 constructs targeting specific ndhC alleles

    • Generate plants with selective knockout of individual alleles

    • Compare phenotypic effects to determine the relative contribution of each allele

This approach builds on techniques used to study allelic variation in complex polyploid genomes, as documented in studies of modern sugarcane hybrids . The allele-defined genome approach has provided new resources for identifying effective alleles of genes in hybrid cultivars, and similar strategies can be applied to distinguish the functions of different ndhC alleles in polyploid sugarcane .

What advanced data analysis approaches can help interpret complex datasets from ndhC functional studies?

Advanced data analysis approaches are essential for extracting meaningful insights from the complex multidimensional datasets generated in ndhC functional studies. The following integrated analytical framework is recommended:

  • Multivariate Statistical Methods:

    • Principal Component Analysis (PCA) to identify major sources of variation

    • Partial Least Squares Regression (PLSR) for correlating spectroscopic data with functional parameters

    • Hierarchical Clustering Analysis (HCA) to identify patterns in phenotypic responses

    • Canonical Correlation Analysis (CCA) to explore relationships between multiple dependent and independent variables

  • Machine Learning Approaches:

    • Random Forest algorithms for identifying key predictors of ndhC function

    • Support Vector Machines (SVM) for classification of functional phenotypes

    • Neural networks for modeling complex non-linear relationships between sequence variations and functional outcomes

    • Ensemble methods combining multiple algorithms for robust prediction

  • Molecular Dynamics Simulations:

    • Homology modeling of ndhC protein structure based on related crystallized proteins

    • Simulation of protein dynamics under different conditions

    • In silico mutagenesis to predict the impact of specific amino acid substitutions

    • Protein-protein interaction modeling for complex assembly prediction

  • Integrated Multi-Omics Analysis:

    • Data integration across transcriptomics, proteomics, and metabolomics datasets

    • Network analysis to identify functional modules and regulatory relationships

    • Pathway enrichment analysis to contextualize findings within cellular processes

    • Bayesian network approaches for causal relationship inference

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.