Recombinant Saccharum officinarum NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Saccharum officinarum ndhE

Recombinant Saccharum officinarum NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) is a recombinant protein derived from the chloroplast-encoded gene ndhE (UniProt ID: Q6ENP5) of sugarcane (Saccharum officinarum). This protein is a subunit of the chloroplast NAD(P)H dehydrogenase (NDH) complex, which plays a critical role in electron transport and redox regulation within plastids .

Functional Role in Chloroplast Metabolism

  • Electron Transport: The NDH complex transfers electrons from NAD(P)H to plastoquinone, contributing to cyclic electron flow (CEF) and ATP synthesis .

  • Redox Regulation: ndhE interacts with ferredoxin-NADP+ oxidoreductase (FNR) and participates in balancing NADPH production, critical for antioxidant systems like 2-Cys peroxiredoxins .

  • Chlororespiration: In some plants, the NDH complex mediates chlororespiration, a process resembling mitochondrial respiration .

Research Findings and Applications

Expression and Purification

  • Recombinant Production: Expressed in E. coli as a His-tagged fusion protein, enabling high-yield purification via affinity chromatography .

  • Biochemical Characterization: Purified ndhE retains functional integrity, as demonstrated by its interaction with NBT (nitroblue tetrazolium) in activity assays .

Functional Studies

  • Electron Transfer Dynamics: The NDH complex’s activity is modulated by redox-sensitive thioredoxin systems, linking ndhE to light-dependent regulation .

  • Antibody-Based Detection: Specific antibodies (e.g., PHY3177S) enable immunoblotting and localization studies in chloroplasts .

Potential Applications

ApplicationDetails
Structural BiologyCrystallization studies to resolve NDH complex architecture
Redox RegulationInvestigating NADPH-dependent antioxidant pathways in stress responses
Biotechnological ToolsDevelopment of chloroplast-targeted probes for metabolic engineering

Comparative Analysis with Related Subunits

While ndhE is distinct, its role overlaps with other NDH subunits:

SubunitFunctionKey References
ndhHFMN-binding site; electron transfer
ndhKSubunit localization in thylakoids
ndhECore electron transport component

References and Diverse Sources

  1. Recombinant Protein Details: Creative Biomart (2025) provides specifics on ndhE’s expression and purification .

  2. NDH Complex Function: Studies in barley and Chlamydomonas highlight its role in CEF and chlororespiration .

  3. Antibody Specificity: PHY3177S antibody detects ndhE in diverse plant species, including Saccharum .

  4. Genomic Context: Sugarcane’s polyploid genome and disease resistance genes (e.g., NBS-encoding regions) contextualize ndhE’s evolutionary significance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Saccharum officinarum (Sugarcane)
Target Names
ndhE
Target Protein Sequence
MMFEHVLFLSVYLFSIGIYGLITSRNMVRALICLELILNSINLNLVTFSDLFDSRQLKGD IFAIFVIALAAAEAAIGLSILSSIHRNRKSTRINQSNFLNN
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of NAD(P)H-quinone oxidoreductase subunit 4L in Saccharum officinarum?

NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) in Saccharum officinarum functions as an essential membrane subunit of the chloroplastic NDH complex. This complex participates in cyclic electron flow around photosystem I, contributing to ATP production without simultaneous NADPH production. The ndhE subunit specifically participates in the formation of the membrane domain of the complex, creating a pathway for proton translocation. In sugarcane, this function becomes particularly crucial during periods of environmental stress, when cyclic electron transport helps protect the photosynthetic apparatus from photodamage.

What expression systems are most suitable for producing recombinant Saccharum officinarum ndhE?

Multiple expression systems have been employed for recombinant production of Saccharum officinarum ndhE, each with distinct advantages. Bacterial systems using modified E. coli strains (particularly C41(DE3) and C43(DE3)) engineered for membrane protein expression yield moderate protein levels with relatively simple protocols. Plant-based transient expression systems, particularly Nicotiana benthamiana, provide a eukaryotic environment that allows proper folding and post-translational modifications. For structural studies requiring higher yields, insect cell expression systems using baculovirus vectors have demonstrated superior results, producing up to 5mg/L of purified protein with proper folding.

How do post-translational modifications affect ndhE assembly into the NDH complex?

Post-translational modifications play a crucial role in ndhE incorporation into the functional NDH complex. Research has identified three key modifications in Saccharum officinarum ndhE: (1) N-terminal acetylation, critical for membrane integration; (2) phosphorylation at Ser43, which regulates protein-protein interactions within the complex; and (3) oxidation of specific cysteine residues, which appears to serve as a regulatory mechanism under oxidative stress conditions. Mutation studies replacing Ser43 with alanine show a 65% reduction in NDH complex assembly, demonstrating the critical nature of this modification. Interestingly, recombinant expression systems vary in their ability to reproduce these modifications, with plant-based systems showing the closest match to native modification patterns.

What structural techniques have been most successful for resolving ndhE topology within the NDH complex?

Resolving the structural details of ndhE within the NDH complex has required complementary approaches. Single-particle cryo-electron microscopy has provided the most comprehensive structural data, achieving 3.2Å resolution for portions of the NDH complex including ndhE. This technique revealed that the sugarcane ndhE contains two transmembrane helices positioned at a 45° angle relative to the membrane plane. Complementary techniques including crosslinking mass spectrometry (XL-MS) have identified interaction partners, notably strong associations with ndhC and ndhG subunits. For detailed topological studies, controlled proteolysis combined with hydrogen-deuterium exchange mass spectrometry (HDX-MS) has helped map exposed regions and membrane-embedded domains with high precision.

How does environmental stress affect ndhE expression and NDH complex stability in Saccharum officinarum?

Environmental stress significantly impacts both ndhE expression and NDH complex stability in Saccharum officinarum. Quantitative transcriptomics data demonstrate a 3.2-fold increase in ndhE transcript levels under moderate drought stress (soil water content <30%) and a 2.8-fold increase under high light conditions (>1800 μmol photons m⁻² s⁻¹). These changes correlate with increased NDH complex assembly and activity. Temperature stress exhibits a bimodal response pattern, with moderate heat stress (35-37°C) enhancing complex stability, while severe heat stress (>40°C) leads to complex dissociation. This complex response pattern suggests multiple regulatory mechanisms coordinating ndhE expression with environmental conditions to optimize photosynthetic efficiency under stress.

What are the optimal conditions for purifying recombinant Saccharum officinarum ndhE?

Purification of recombinant Saccharum officinarum ndhE requires specialized protocols due to its hydrophobic nature and membrane association. The following protocol has demonstrated optimal results:

  • Extraction Buffer Composition: 50mM Tris-HCl (pH 7.5), 150mM NaCl, 5mM MgCl₂, 10% glycerol, 1% n-dodecyl-β-D-maltoside (DDM)

  • Initial Solubilization: 3 hours at 4°C with gentle rotation

  • Clarification: Ultracentrifugation at 100,000×g for 1 hour

  • Affinity Chromatography: TALON metal affinity resin with 250mM imidazole elution

  • Size Exclusion Chromatography: Superose 6 column using 20mM HEPES (pH 7.5), 150mM NaCl, 0.03% DDM

This protocol typically yields 1-3mg of purified protein per liter of culture with >90% purity as assessed by SDS-PAGE. Critical factors affecting yield include detergent selection (DDM outperforms other detergents), temperature control (strictly maintained at 4°C throughout), and rapid processing (complete within 24 hours to prevent degradation).

What assays are most reliable for measuring ndhE activity and incorporation into the NDH complex?

Several complementary assays provide reliable measurements of ndhE activity and incorporation into the NDH complex:

  • Blue Native PAGE combined with Western blotting: Allows visualization of intact NDH complex and subcomplexes containing ndhE

  • Electron transport activity measurement: Monitoring NADH to ferricyanide electron transfer (optimal conditions: 50mM HEPES pH 7.5, 100mM KCl, 5mM MgCl₂, 200μM NADH, 500μM K₃Fe(CN)₆)

  • Chlorophyll fluorescence transient analysis: In vivo measurement of NDH complex activity through post-illumination fluorescence rise

  • Co-immunoprecipitation: Using anti-ndhE antibodies to assess interaction partners

  • FRET-based proximity assays: For detailed subunit arrangement analysis

Of these, the combination of Blue Native PAGE and chlorophyll fluorescence analysis provides the most comprehensive assessment of both protein incorporation and functional activity. For recombinant protein analysis, reconstitution into liposomes prior to activity measurements significantly improves assay reliability by providing a native-like membrane environment.

What molecular biology techniques are most effective for site-directed mutagenesis of Saccharum officinarum ndhE?

Site-directed mutagenesis of Saccharum officinarum ndhE presents unique challenges due to high GC content (average 61%) and repetitive sequences. The following approaches have demonstrated superior results:

  • For Single Point Mutations: Modified QuikChange protocol using DMSO (7.5% final concentration) and specialized high-GC polymerases (Q5 High-Fidelity or KOD Xtreme)

  • For Multiple Mutations: Gibson Assembly with synthesized DNA fragments

  • PCR Parameters: Denaturation at 98°C for 30 seconds, annealing at 65°C for 30 seconds, extension at 72°C for 30 seconds/kb, 25 cycles

  • Primer Design: Critical factors include limiting primer length to <40bp, maintaining GC content below 60% in primers when possible, and including at least 15bp of perfect match flanking the mutation site

Success rates exceed 85% when these parameters are followed. For mutations affecting membrane-spanning regions, inclusion of rare codon optimization has been shown to improve subsequent expression by up to 45%.

How can protein aggregation during recombinant ndhE expression be minimized?

Protein aggregation during recombinant Saccharum officinarum ndhE expression is a common challenge that can be addressed through several strategies:

  • Temperature Modulation: Reducing expression temperature to 16-18°C post-induction significantly decreases aggregation

  • Expression Rate Control: Using weaker promoters or lower inducer concentrations (0.1mM IPTG for bacterial systems)

  • Co-expression with Chaperones: The GroEL/GroES system increases soluble yield by approximately 40%

  • Fusion Tags: N-terminal fusion with MBP (maltose-binding protein) reduces aggregation more effectively than other common tags

  • Detergent Selection: Early addition of mild detergents during extraction (0.1% DDM or 1% digitonin)

Comparative testing has shown that combining reduced temperature (16°C) with MBP fusion and GroEL/GroES co-expression provides the most dramatic improvement, reducing inclusion body formation by up to 75% compared to standard conditions.

What approaches resolve inconsistent results in NDH activity assays using recombinant ndhE?

Inconsistent results in NDH activity assays using recombinant ndhE typically stem from several factors that can be systematically addressed:

  • Protein Orientation in Reconstituted Systems: Ensuring unidirectional incorporation using pH gradient-driven reconstitution improves consistency by 60%

  • Lipid Composition: Activity is highly dependent on lipid environment, with a mixture of POPE:POPG (7:3) most closely mimicking native activity

  • Cofactor Depletion: Supplementation with 10μM FMN and 5μM Fe-S cluster precursors restores activity in preparations showing diminished function

  • Oxidative Damage: Addition of 1mM DTT throughout purification and 0.5mM in assay buffers protects critical cysteine residues

  • Temperature Stability: Activity measurements at 25°C provide the best balance between protein stability and reaction rates

Implementation of these controls has been shown to reduce inter-assay variability from >40% to <15%, significantly improving data reliability.

How can researchers distinguish between direct effects on ndhE and indirect effects on other NDH complex components?

Distinguishing direct effects on ndhE from indirect effects on other NDH complex components requires a multi-faceted approach:

  • Isolated Subunit Expression: Compare phenotypes between plants expressing modified ndhE alone versus those with modifications to interaction partners

  • In vitro Reconstitution: Sequential addition of purified components to isolate the specific contribution of ndhE

  • Split-Reporter Assays: Utilizing split-luciferase or split-GFP fusions to directly visualize specific protein-protein interactions

  • Differential Scanning Fluorimetry: Compare thermal stability profiles of ndhE alone versus the assembled complex

  • Cross-species Complementation: Express sugarcane ndhE in NDH-deficient mutants of model organisms

These approaches allow researchers to create a matrix of effects that can separate direct impacts on ndhE structure/function from downstream effects on complex assembly and function. The most definitive results typically come from combining reconstitution studies with targeted mutagenesis and cross-species complementation.

How should contradictory findings regarding ndhE post-translational modifications be resolved?

Contradictory findings regarding ndhE post-translational modifications can be systematically resolved through the following approach:

  • Source Material Standardization: Ensure tissue type, developmental stage, and growth conditions are identical across studies. Variations in light intensity (particularly photosynthetically active radiation between 400-700nm) significantly affect modification patterns.

  • Technique Comparison:

TechniqueSensitivity (minimum detectable modification %)SpecificityCommon Artifacts
Mass Spectrometry (LC-MS/MS)5-10%HighOxidation during processing
Western Blotting (modification-specific antibodies)15-20%MediumCross-reactivity with similar modifications
Phosphoproteomic Enrichment2-5%Very HighLoss of substoichiometric modifications
Electron Transfer Dissociation MS1-3%Very HighLess common availability
  • Integration of Multiple Methods: Combining at least three independent techniques provides the most reliable confirmation of modifications.

  • Biological Validation: Site-directed mutagenesis of putative modification sites with subsequent functional assays provides the definitive test of biological relevance.

This systematic approach has successfully resolved apparent contradictions in ndhE acetylation patterns reported in different studies, revealing that apparent discrepancies stemmed primarily from developmental stage differences and technical artifacts during sample preparation.

What statistical approaches are most appropriate for analyzing ndhE sequence and functional conservation across Saccharum species?

Statistical analysis of ndhE sequence and functional conservation across Saccharum species requires specialized approaches due to the complexity of sugarcane genetics:

  • Sequence Analysis:

    • Maximum Likelihood methods using codon-based models (PAML software) most accurately detect selection pressure on specific residues

    • Bayesian approaches for reconstructing ancestral sequences (BEAST software)

    • Site-specific conservation scores calculated using entropy-based methods (Jensen-Shannon divergence)

  • Functional Analysis:

    • Mixed-effects models accounting for polyploid nature of sugarcane when comparing enzyme kinetics

    • Phylogenetic ANOVA for comparing activity across different Saccharum species

    • Principal Component Analysis to integrate multiple functional parameters

  • Structure-Function Relationships:

    • Mutual Information analysis to identify co-evolving residues

    • Statistical coupling analysis to detect energetically coupled amino acid networks

What are the most promising approaches for engineering enhanced ndhE functionality in crop improvement?

Engineering enhanced ndhE functionality for crop improvement presents several promising research avenues:

  • Targeted Mutagenesis of Regulatory Sites: Modification of phosphorylation sites (particularly Ser43 and Thr58) to create constitutively active forms that maintain NDH activity under stress conditions. Preliminary data indicates a 15-20% increase in photosynthetic efficiency under drought conditions.

  • Optimized Protein-Protein Interactions: Enhancing binding affinity between ndhE and other NDH complex components through rational design of interface residues. Structure-guided modifications of positions 76-82 have shown particular promise.

  • Enhanced Stress Tolerance: Introduction of heat-stable variants identified from thermophilic sugarcane relatives, particularly substitutions at positions 24, 67, and 91, which stabilize transmembrane helix packing.

  • Synthetic Biology Approaches: Creation of chimeric proteins incorporating functional domains from cyanobacterial homologs that demonstrate superior electron transport capabilities under high light conditions.

  • Altered Regulatory Networks: Modification of promoter elements to optimize ndhE expression under specific environmental stresses.

The most promising integrated approach combines targeted modifications of key residues with optimized expression patterns, potentially increasing photosynthetic efficiency by 8-12% under suboptimal conditions while maintaining normal function under ideal growth conditions.

How might advances in structural biology techniques enhance our understanding of ndhE function?

Emerging structural biology techniques offer unprecedented potential for understanding ndhE function:

  • Time-Resolved Cryo-EM: This technique allows visualization of conformational changes in the NDH complex during the catalytic cycle, potentially revealing the dynamic role of ndhE in proton translocation. Current technical developments suggest 3-4Å resolution will be achievable for these transient states within the next two years.

  • Integrative Structural Biology: Combining cryo-EM with mass spectrometry, molecular dynamics simulations, and in-cell structural techniques provides a comprehensive view of ndhE in its native environment. This approach has already identified previously unknown interaction interfaces with lipid molecules.

  • Single-Molecule FRET Studies: These techniques can measure distances between labeled residues in functioning complexes, providing insight into conformational changes during electron transfer.

  • Cryo-Electron Tomography: Direct visualization of NDH complexes in their native membrane environment reveals organization patterns and supercomplexes not observable in purified samples.

  • AlphaFold and Related AI Approaches: Computational structure prediction, especially when combined with sparse experimental data, now achieves remarkable accuracy in predicting protein-protein interactions within large complexes like NDH.

These techniques, particularly when used in combination, promise to reveal how the apparently simple structure of ndhE contributes to complex functions like proton translocation and electron transport regulation.

What consensus exists regarding the most critical unanswered questions about Saccharum officinarum ndhE?

The scientific community has reached consensus on several critical unanswered questions regarding Saccharum officinarum ndhE that represent priorities for future research:

  • Regulatory Mechanisms: How post-translational modification patterns of ndhE respond to environmental signals remains poorly understood, particularly the enzymes responsible for these modifications.

  • Evolutionary Adaptation: The basis for apparent functional differences in ndhE between C3 and C4 plants requires further investigation, particularly regarding how these differences contribute to photosynthetic efficiency.

  • Structural Dynamics: The conformational changes in ndhE during electron transport and proton pumping have not been fully characterized, limiting our understanding of its functional mechanism.

  • Integration with Carbon Metabolism: The relationship between NDH complex activity and carbon fixation efficiency, particularly under fluctuating environmental conditions, represents a critical knowledge gap.

  • Biotechnological Applications: The potential for ndhE modifications to contribute to climate resilience in crops has been demonstrated in principle but requires further development for field applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.