Recombinant Saccharum officinarum NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Saccharum officinarum (Sugarcane)
Target Names
ndhG
Target Protein Sequence
MDLPGPIHEILVLFGGFVLLLGGLGVVLLTNPIYSAFSLGLVLVCISLFYFLLNSYFVAV AQLLIYVGAINVLIIFAVMFVNGSEWSKDKNYWTIGDGFTLLLCITIPFSLMTTIPDTSW YGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISLILLVSLIGAITMARQ
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this specific species, the immediate electron acceptor for NDH is believed to be plastoquinone. This enzyme couples the redox reaction with proton translocation, conserving the redox energy in a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) and what is its role in chloroplast function?

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) is a protein component of the chloroplastic NAD(P)H dehydrogenase (NDH) complex in plants. This complex, encoded partly by the chloroplast genome, functions in cyclic electron transport around photosystem I and chlororespiration. The ndhG subunit is specifically involved in forming the membrane domain of the NDH complex and participates in proton translocation across the thylakoid membrane.

The full protein name includes several alternative designations:

  • NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (EC= 1.6.5.-)

  • NAD(P)H dehydrogenase subunit 6

  • NADH-plastoquinone oxidoreductase subunit 6

How does ndhG interact with other subunits in the chloroplastic NDH complex?

The NDH complex in chloroplasts consists of multiple subunits, including ndhG (subunit 6) and other components like ndhB (subunit 2). While the search results don't provide specific interaction data for sugarcane ndhG, comparative studies with related organisms suggest that ndhG interacts primarily with other membrane-embedded subunits to form the proton-translocating domain of the complex.

Research in Arabidopsis thaliana indicates that the NDH complex interacts with photosystem I through specific protein-protein interactions, forming an NDH-PSI supercomplex that enhances cyclic electron flow efficiency. The stability of this supercomplex appears to be influenced by factors such as PGR5 (PROTON GRADIENT REGULATION5) .

What experimental approaches are used to study the function of recombinant ndhG in photosynthetic efficiency?

Researchers typically employ several approaches to study ndhG function:

  • Reverse genetics approaches: CRISPR/Cas9-mediated knockout or RNAi-based knockdown of ndhG to assess its role in photosynthesis

  • Chlorophyll fluorescence measurements: To measure alterations in electron transport rates and cyclic electron flow

  • Biochemical assays: Using recombinant protein to measure NAD(P)H oxidation activity

  • Protein-protein interaction studies: Co-immunoprecipitation and yeast two-hybrid analysis to identify interacting partners

The functional importance of ndhG can be assessed by measuring photosynthetic parameters under various stress conditions, particularly during high light intensity or drought stress, when cyclic electron flow becomes more important for photoprotection.

How does environmental stress affect ndhG expression and NDH complex activity?

While specific data for sugarcane ndhG is limited in the search results, studies in other plant species have shown that NDH complex activity and subunit expression are upregulated under various environmental stresses, including:

  • High light intensity

  • Drought stress

  • Temperature extremes

  • Nutrient deficiency

These stresses typically increase the demand for cyclic electron flow to maintain the correct ATP/NADPH ratio and to prevent photodamage. The regulation of ndhG expression under stress conditions in sugarcane would be a valuable area for future research, particularly given sugarcane's importance as a crop and its cultivation in various environmental conditions .

What is the recommended protocol for expressing and purifying recombinant Saccharum officinarum ndhG?

Based on established protocols for similar membrane proteins and the available product information, researchers can follow this general methodology:

  • Cloning and vector selection:

    • Clone the ndhG coding sequence (1-176 amino acids) into an expression vector with an appropriate tag (His-tag is commonly used)

    • Select a vector with a strong promoter suitable for the expression system

  • Expression system options:

    • Bacterial expression (E. coli)

    • Yeast expression (P. pastoris)

    • Insect cell expression (Baculovirus system)

    • Cell-free expression systems (for membrane proteins)

  • Purification strategy:

    • Membrane fraction isolation by ultracentrifugation

    • Solubilization with appropriate detergents (DDM, LDAO, or similar mild detergents)

    • Affinity chromatography (Ni-NTA for His-tagged proteins)

    • Size exclusion chromatography for final purification

  • Storage conditions:

    • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

What experimental approaches are recommended for studying ndhG protein-protein interactions?

Several complementary approaches can be employed to study ndhG interactions with other proteins:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against ndhG or its tag to pull down interacting proteins

    • Identify binding partners by mass spectrometry

  • Yeast two-hybrid (Y2H) or split-ubiquitin assays:

    • Particularly useful for membrane proteins like ndhG

    • Can identify direct protein-protein interactions

  • Bimolecular fluorescence complementation (BiFC):

    • Visualize protein interactions in planta

    • Provides spatial information about where interactions occur

  • Crosslinking coupled with mass spectrometry:

    • Identify interaction interfaces at amino acid resolution

    • Useful for determining the structural organization of the NDH complex

  • Blue native PAGE:

    • Analyze intact protein complexes

    • Can reveal subcomplexes and assembly intermediates

These methodologies would help elucidate how ndhG integrates into the NDH complex and interacts with other components of the photosynthetic apparatus.

How can researchers effectively use antibodies against ndhG for localization and functional studies?

While specific anti-ndhG antibodies aren't mentioned in the search results, approaches similar to those used for NdhB can be applied:

  • Antibody generation:

    • Use KLH-conjugated synthetic peptides derived from unique regions of the ndhG sequence

    • Generate polyclonal antibodies in rabbits or other suitable hosts

    • Validate antibody specificity against recombinant protein and plant extracts

  • Immunolocalization studies:

    • Immunogold labeling for transmission electron microscopy

    • Immunofluorescence for confocal microscopy

    • Western blotting to detect the protein in different cellular fractions

  • Functional studies:

    • Immunodepletion to remove the protein from biochemical assays

    • Antibody inhibition studies to block protein function

    • Co-immunoprecipitation to identify interacting partners

  • Expression analysis:

    • Western blotting to quantify protein levels under different conditions

    • Immunohistochemistry to determine tissue-specific expression patterns

What are the potential applications of recombinant ndhG in metabolic engineering of sugarcane?

Recombinant ndhG could be utilized in several ways to improve sugarcane characteristics:

  • Enhanced photosynthetic efficiency:

    • Overexpression or optimization of ndhG could potentially improve cyclic electron flow

    • This might lead to better performance under stress conditions and higher yields

  • Stress tolerance improvement:

    • Modulating ndhG expression could enhance tolerance to drought, high light, and temperature stress

    • This would be particularly valuable for sugarcane cultivation in marginal lands

  • Biomarker development:

    • ndhG expression levels or modifications could serve as biomarkers for stress responses

    • This could facilitate early detection of plant stress in field conditions

  • Photosynthetic pathway engineering:

    • ndhG manipulation could be part of broader strategies to optimize the ATP/NADPH ratio

    • This might improve carbon fixation efficiency and biomass accumulation

What are the current knowledge gaps in understanding ndhG function in Saccharum officinarum?

Several important research questions remain unanswered:

  • Regulatory mechanisms:

    • How is ndhG expression regulated at transcriptional and post-transcriptional levels?

    • What signaling pathways control ndhG expression in response to environmental cues?

  • Structural insights:

    • What is the precise three-dimensional structure of ndhG and its arrangement in the NDH complex?

    • Which domains are critical for protein-protein interactions and function?

  • Evolutionary aspects:

    • How has ndhG evolved in Saccharum officinarum compared to other plants?

    • Are there species-specific adaptations in ndhG structure or function?

  • Functional redundancy:

    • Are there alternative electron transport pathways that can compensate for reduced ndhG function?

    • How do these pathways interact with ndhG-dependent processes?

Addressing these knowledge gaps would significantly advance our understanding of photosynthetic processes in sugarcane and could lead to applications in crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.