Recombinant Saccharum officinarum Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Saccharum officinarum (Sugarcane)
Target Names
ycf4
Target Protein Sequence
MNWRSEHIWIELLKGSRKRGNFFWACILFLGSLGFLAVGASSYLGKNMISVLPSQQILFF PQGVVMSFYGIAGLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGIKRRIFLQF LVRDIQSIRIQVKEGLYPRRILYMEIRGQGVIPLTRTDEKFFTPREIEQKAAELAYFLRV PIEVF
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 and what is its primary function in photosynthetic organisms?

Ycf4 (hypothetical chloroplast reading frame no. 4) is a chloroplast-encoded protein that functions primarily as an assembly factor for Photosystem I (PSI). It is localized to the thylakoid membrane and plays a critical role in the stable accumulation of the PSI complex. Research in Chlamydomonas reinhardtii has demonstrated that Ycf4 is essential for photoautotrophic growth in this organism, as transformants lacking ycf4 are unable to grow photoautotrophically and show severe deficiency in PSI activity . The protein appears to act as a scaffold for PSI assembly, interacting with newly synthesized PSI polypeptides during their assembly process .

How conserved is the Ycf4 protein sequence across different photosynthetic organisms?

Ycf4 displays significant sequence conservation across diverse photosynthetic organisms. For example, the Chlamydomonas reinhardtii Ycf4 amino acid sequence shows substantial identity with Ycf4 sequences from land plants (43.2–48.6%), the Euglenophyte Euglena gracilis (41.3%), the diatom Odontella sinensis (47.5%), the cyanelle of Cyanophora paradoxa (49.7%), the red alga Porphyra purpurea (52.2%), and the cyanobacterium Synechocystis sp. strain PCC 6803 (45.8%) . This high degree of conservation suggests a fundamental role in photosynthesis that has been maintained throughout evolution, making Saccharum officinarum Ycf4 studies relevant in the broader context of photosynthesis research.

How is the ycf4 gene organized and expressed in the chloroplast genome?

In Chlamydomonas reinhardtii, ycf4 is co-transcribed as part of a polycistronic transcriptional unit (rps9–ycf4–ycf3–rps18) into RNAs of 8.0 kb and 3.0 kb corresponding to the entire unit and to rps9–ycf4–ycf3, respectively . This genomic organization may be similar in Saccharum officinarum, although species-specific differences in chloroplast gene arrangement can exist. The polycistronic nature of ycf4 expression suggests coordinated regulation with other photosynthetic components, which is an important consideration when designing expression studies or genetic manipulations of this gene.

What is the stoichiometry of Ycf4 relative to PSI components?

Quantitative analyses in Chlamydomonas reinhardtii have determined that Ycf4 is present in stoichiometric amounts relative to PSI, with approximately 1.2 Ycf4 molecules per P700 reaction center . This 1:1 stoichiometry contrasts with Ycf3, which is present at much lower levels (0.03–0.06 Ycf3 per P700) . The stoichiometric presence of Ycf4 suggests a direct role in PSI assembly or stability, possibly serving as a scaffold for each assembling PSI complex.

How does light and chlorophyll availability affect Ycf4 accumulation?

The accumulation of Ycf4 is significantly reduced under conditions where chlorophyll synthesis is inhibited. In Chlamydomonas reinhardtii y-1 mutant cells (unable to synthesize chlorophyll) grown in the dark, Ycf4 accumulates to only 30–50% of the levels observed in light-grown cells . Upon illumination, Ycf4 levels rise before the appearance of PSI subunits during the greening period . This dependency on light/chlorophyll suggests coordination between Ycf4 expression and the availability of chlorophyll for PSI assembly, which should be considered when designing experiments involving recombinant Ycf4 expression.

How does the function of Ycf4 differ between algae and higher plants?

A significant functional difference exists in the essentiality of Ycf4 between algae and higher plants. While Ycf4 is absolutely required for photoautotrophic growth in the green alga Chlamydomonas reinhardtii, with ycf4-disrupted transformants being completely unable to grow photoautotrophically , tobacco (Nicotiana tabacum) ycf4 knockout mutants can still perform photosynthesis, albeit at reduced efficiency . These higher plant mutants are capable of assembling sufficient amounts of PSI to allow for slow autotrophic growth . This suggests that alternative PSI assembly pathways might exist in higher plants, which could potentially also apply to Saccharum officinarum.

What protein complexes does Ycf4 form during PSI assembly?

Biochemical studies using tandem affinity purification in Chlamydomonas have isolated a large stable Ycf4-containing complex exceeding 1500 kD . This complex contains the opsin-related protein COP2 and several PSI subunits, including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . Electron microscopy revealed that the largest structures in the purified preparation measure 285 × 185 Å, which may represent oligomeric states of the complex . Pulse-chase protein labeling experiments demonstrated that the PSI polypeptides associated with this Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex . This evidence strongly supports the hypothesis that the Ycf4 complex functions as a scaffold for PSI assembly.

How do mutations in ycf4 affect thylakoid membrane organization and other photosynthetic complexes?

Knockout studies in Chlamydomonas reinhardtii have shown that while ycf4 disruption dramatically affects PSI accumulation, it does not significantly impact other thylakoid protein complexes . The levels of PSII, cytochrome b6/f complex, ATP synthase, and light-harvesting complex (LHC) remain unaffected in ycf4-deficient mutants . This specificity distinguishes Ycf4 from more general factors affecting thylakoid membrane biogenesis and suggests its highly specialized role in PSI assembly. When working with recombinant Saccharum officinarum Ycf4, researchers should expect similar specificity for PSI.

What are the most effective methods for disrupting or modifying the ycf4 gene in chloroplasts?

For chloroplast gene manipulation, biolistic transformation (particle gun) has proven effective for disrupting ycf4, as demonstrated in both Chlamydomonas reinhardtii and tobacco . In Chlamydomonas studies, the aadA expression cassette (conferring spectinomycin resistance) was inserted at specific restriction sites within the ycf4 gene . Transformants were selected based on antibiotic resistance and subjected to multiple rounds of single colony purification under selective conditions to achieve homoplasmy (complete replacement of all wild-type copies of the chloroplast genome) . Southern blot hybridization can confirm successful gene disruption and homoplasmic state. When working with Saccharum officinarum, similar approaches can be applied, though optimization for this species may be necessary.

What is the recommended protocol for isolating and purifying recombinant Ycf4 complexes?

For isolating intact Ycf4-containing complexes, a tandem affinity purification approach has proven successful in Chlamydomonas reinhardtii . This involves:

  • Creating a tagged version of Ycf4 with appropriate affinity tags

  • Expression in the target organism

  • Cell disruption under gentle conditions to preserve protein complexes

  • Initial purification by sucrose gradient ultracentrifugation

  • Further purification by ion exchange column chromatography

This approach allowed researchers to isolate a stable Ycf4-containing complex of >1500 kD that included associated proteins and PSI subunits . For recombinant Saccharum officinarum Ycf4, similar purification strategies could be employed, with potentially necessary modifications for plant-specific cellular compositions.

How can pulse-chase labeling be used to study Ycf4's role in PSI assembly?

Pulse-chase protein labeling has been instrumental in demonstrating that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and represent partially assembled subcomplexes . To implement this technique:

  • Expose cells to radioactively labeled amino acids (typically 35S-methionine/cysteine) for a short "pulse" period

  • Chase with excess unlabeled amino acids

  • Isolate the Ycf4 complex at different time points following the chase

  • Analyze associated labeled proteins by autoradiography after SDS-PAGE

This approach can reveal the temporal dynamics of PSI assembly and the role of Ycf4 as a scaffold for newly synthesized PSI components in Saccharum officinarum.

How should researchers interpret differences in PSI assembly between Saccharum officinarum and model organisms?

When comparing Saccharum officinarum Ycf4 function to that in model organisms, consider the following analytical framework:

ParameterChlamydomonas reinhardtiiHigher Plants (e.g., Tobacco)Potential in Saccharum officinarum
Essentiality for PSIEssential - no photoautotrophic growth without Ycf4 Non-essential - slow photoautotrophic growth possible Likely closer to higher plants
PSI assembly efficiencyComplete dependence on Ycf4 Partial dependence Potentially partial dependence
Complex formationForms large (>1500 kD) complexes with PSI subunits Less extensively characterizedMay form similar complexes
Partner proteinsAssociates with COP2 Not fully characterizedSpecies-specific interactions possible

When interpreting experimental results, researchers should consider the evolutionary position of Saccharum officinarum relative to these model organisms and the potential for species-specific adaptations in the PSI assembly pathway.

What control experiments are essential when characterizing recombinant Ycf4 function?

When characterizing recombinant Saccharum officinarum Ycf4 function, the following controls are essential:

  • Wild-type controls to establish baseline PSI accumulation and function

  • Complementation assays with the recombinant protein in ycf4-deficient backgrounds to confirm functional activity

  • Analysis of other photosynthetic complexes (PSII, cytochrome b6/f, ATP synthase) to confirm specificity of Ycf4 effects

  • Examination of Ycf4 accumulation in mutants lacking PSI to confirm independence of expression

  • Comparative analyses with Ycf4 from other species to identify conserved and divergent functions

These controls help establish the specific role of recombinant Ycf4 and distinguish primary effects from secondary consequences.

What aspects of Ycf4 function remain poorly understood and merit further investigation?

Despite substantial progress in understanding Ycf4 function, several critical aspects remain to be elucidated:

  • The precise molecular mechanism by which Ycf4 facilitates PSI assembly

  • The structural details of the interaction between Ycf4 and nascent PSI subunits

  • The reason for differential essentiality between algae and higher plants

  • The complete composition and structure of the Ycf4-containing complex

  • Potential secondary functions beyond PSI assembly

  • Species-specific variations in Ycf4 function and regulation

Research addressing these questions with recombinant Saccharum officinarum Ycf4 could provide valuable insights into the evolution and optimization of photosynthetic assembly mechanisms.

How might advances in cryo-electron microscopy contribute to understanding Ycf4 structure and function?

Cryo-electron microscopy (cryo-EM) represents a powerful approach for elucidating the structure of the Ycf4-containing complex at near-atomic resolution. Previous electron microscopy studies identified large structures (285 × 185 Å) in purified Ycf4 complex preparations , but lacked the resolution to determine detailed molecular arrangements. Modern cryo-EM could:

  • Reveal the precise structural organization of the Ycf4 complex

  • Identify interaction interfaces between Ycf4 and PSI subunits

  • Visualize conformational changes during the assembly process

  • Provide insights into the species-specific structural features of Saccharum officinarum Ycf4

Such structural information would significantly enhance our understanding of the molecular mechanisms underlying Ycf4's function in PSI assembly.

What are the key methodological challenges when working with recombinant Ycf4 from Saccharum officinarum?

Researchers working with recombinant Saccharum officinarum Ycf4 should anticipate several methodological challenges:

  • The chloroplast origin of this protein may require specialized expression systems that provide appropriate post-translational processing and membrane targeting

  • The association of Ycf4 with large protein complexes necessitates gentle extraction and purification methods to maintain native interactions

  • Functional assays must account for the complex's involvement in multi-stage assembly processes rather than enzymatic activities

  • Species-specific differences may necessitate optimization of protocols established in model organisms

  • The membrane association of Ycf4 adds complexity to structural studies and requires appropriate detergents or membrane mimetics

Addressing these challenges requires careful experimental design and potentially the development of specialized methodologies for Saccharum officinarum-specific research.

How should researchers integrate findings from different model systems when studying Saccharum officinarum Ycf4?

When integrating findings from different model systems to study Saccharum officinarum Ycf4, researchers should:

  • Consider the evolutionary relationships between Saccharum officinarum and model organisms

  • Focus on conserved functional domains identified across species

  • Recognize that essentiality may vary between algae and higher plants, with Saccharum likely resembling other angiosperms

  • Account for differences in chloroplast genome organization that may affect expression and regulation

  • Validate model-derived hypotheses directly in Saccharum when possible

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.