Recombinant Saccharum officinarum Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Saccharum officinarum Photosystem II CP47 chlorophyll apoprotein (psbB) is a genetically engineered form of the intrinsic chlorophyll-binding protein critical for Photosystem II (PSII) function. CP47, encoded by the psbB gene, serves as a core antenna complex in PSII, facilitating light energy transfer to the reaction center and stabilizing the oxygen-evolving complex (OEC) . In sugarcane (Saccharum officinarum), recombinant expression enables biochemical and structural studies of this protein under controlled conditions.

Recombinant Production Methodology

Recombinant CP47 is typically produced via the following workflow:

  1. Gene Cloning: The psbB coding sequence (1–508 aa) is codon-optimized for E. coli and inserted into a plasmid .

  2. Transformation: Plasmid is introduced into E. coli strains (e.g., BL21) for heterologous expression.

  3. Induction and Purification: Protein expression is induced with IPTG, followed by affinity chromatography (Ni-NTA for His-tagged proteins) .

  4. Validation: SDS-PAGE confirms >90% purity, and mass spectrometry identifies co-purified subunits (e.g., PsbH, PsbL) .

Key Challenges:

  • Solubility: Requires fusion tags (e.g., His-SUMO) and detergents for membrane protein stabilization .

  • Pigment Retention: Chlorophyll incorporation in vitro often yields lower efficiency compared to in vivo assembly .

Functional Insights from Mutagenesis Studies

  • Chloride Binding: The R448 residue in loop E is critical for chloride coordination. Mutants like R448S exhibit 50% reduced photoautotrophic growth and impaired OEC reactivation under chloride limitation .

  • Photoinactivation: CP47 mutants show increased susceptibility to photodamage, highlighting its role in PSII repair cycles .

Applications in Photosynthesis Research

  1. PSII Assembly Studies: Recombinant CP47 aids in probing early PSII assembly intermediates, such as the "RC47" subcomplex with D1/D2 reaction centers .

  2. Antibody Development: Anti-CP47 antibodies (e.g., Agrisera AS05 084) enable quantitative PSII analysis in plants and algae .

  3. Biotechnological Engineering: Insights from CP47 structure inform the design of synthetic light-harvesting systems .

Limitations and Future Directions

While recombinant CP47 from Spinacia oleracea (spinach) and Draba nemorosa is well-characterized , Saccharum officinarum-specific studies remain scarce. Future work should prioritize:

  • High-resolution cryo-EM structures of sugarcane CP47.

  • Comparative studies on chlorophyll retention efficiency across plant species.

  • Engineering thermostable variants for industrial bioenergy applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize the development of the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Saccharum officinarum (Sugarcane)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSISGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSDGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRRQAA
Uniprot No.

Target Background

Function
CP47 is a core component of the Photosystem II (PSII) complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical processes of PSII. PSII is a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from water, generating oxygen and a proton gradient that is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.