Recombinant Saccharum officinarum Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharum officinarum Photosystem II D2 Protein (psbD)

The Recombinant Saccharum officinarum Photosystem II D2 protein, also known as psbD, is a crucial component of the photosynthetic apparatus in plants. It is part of the core reaction center of Photosystem II (PSII), which plays a pivotal role in oxygenic photosynthesis by capturing light energy and converting it into chemical energy. This protein is essential for the assembly and function of PSII, facilitating the transfer of electrons and the splitting of water into oxygen and hydrogen ions.

Structure and Function of Photosystem II D2 Protein

Photosystem II is a complex located in the thylakoid membranes of chloroplasts and consists of approximately 20 subunits, including the D2 protein. The core of PSII is formed by a heterodimer of two structurally related proteins, D1 and D2, which are crucial for the initial steps of photosynthesis . The D2 protein, like D1, contains several loop regions, including the stroma-exposed D-de loop, which is phylogenetically conserved and plays a role in maintaining the structural integrity of PSII .

Recombinant Expression of Saccharum officinarum D2 Protein

Recombinant expression of the Saccharum officinarum Photosystem II D2 protein involves cloning the psbD gene into a suitable expression vector and expressing it in a host organism, such as Escherichia coli. This approach allows for the production of large quantities of the protein for research purposes, including structural studies and functional assays .

Research Findings and Applications

Research on the D2 protein has focused on its role in PSII assembly and function. Studies in Synechocystis have shown that accumulation of the D2 protein is a key regulatory step for the assembly of the PSII reaction center complex . Mutations in the D2 protein can affect PSII function, but the protein's structure can accommodate significant changes without compromising its role in photosynthesis .

Table 1: Components of Photosystem II

ComponentFunction
Chlorophyll aAbsorbs light energy and converts it to chemical energy
Beta-caroteneQuenches excess photoexcitation energy
Heme B559Acts as a secondary electron carrier in Cytochrome b559
PheophytinPrimary electron acceptor in the electron transport chain
Mn4CaO5 ClusterEssential for water oxidation to produce oxygen and protons

Table 2: Characteristics of Recombinant Saccharum officinarum D2 Protein

CharacteristicDescription
Expression HostTypically Escherichia coli
TagOften His-tagged for easy purification
LengthApproximately 353 amino acids (similar to other plant D2 proteins)
FunctionEssential for PSII assembly and electron transport

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will strive to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing of the protein is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Saccharum officinarum (Sugarcane)
Target Names
psbD
Target Protein Sequence
MTIAVGRVTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAISFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors. D2 is essential for the assembly of a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of PsbD (D2) protein in Photosystem II?

The D2 protein (PsbD) forms the reaction core of Photosystem II (PSII) as a heterodimer with the D1 protein (PsbA). PsbD is homologous to the D1 protein but has a slightly higher molecular mass of approximately 39.5 kDa . Functionally, D2 works in concert with D1 to facilitate electron transfer from water to plastoquinone, enabling PSII to function as a water-plastoquinone oxidoreductase .

The protein contains multiple transmembrane helices and loop regions, including an extended stroma-exposed loop between transmembrane helix D and parallel helix de (the D-de loop), which is phylogenetically conserved . This structural arrangement is critical for maintaining the proper architecture of the PSII reaction center. The accumulation of D2 protein represents a key regulatory step in the assembly of the PSII reaction center complex .

What approaches are recommended for isolating and detecting recombinant sugarcane D2 protein?

For isolation of recombinant sugarcane D2 protein, researchers should consider:

  • Membrane protein extraction protocols: Use detergent-based extraction methods (such as n-dodecyl β-D-maltoside or Triton X-100) optimized for hydrophobic membrane proteins.

  • Sequential solubilization: Implement a step-wise solubilization approach to separate D2 from other membrane components.

  • Chromatography techniques: Apply a combination of ion exchange, size exclusion, and affinity chromatography for purification.

For detection, immunological methods using specific antibodies have proven effective. Global antibodies against PsbD, such as the rabbit polyclonal antibody AS06 146, recognize D2 protein across multiple species including various plants, algae and cyanobacteria . Western blotting remains the standard technique for detection and quantification, with samples normalized by fresh weight and fractionated by SDS-PAGE . When working with recombinant systems, including affinity tags (His, GST, or FLAG) can facilitate both purification and detection.

How does the expression level of recombinant D2 protein relate to PSII assembly?

The expression and accumulation of D2 protein represents a critical threshold event in PSII assembly. Studies in cyanobacteria have demonstrated that in mutants lacking D2, other PSII proteins (including D1, CP47, and cytochrome b559) fail to form proper complexes despite being synthesized . This indicates that:

  • D2 serves as a nucleation point for initial PSII complex assembly

  • Stable accumulation of other PSII components depends on the presence of properly folded D2

  • Assembly of the reaction center complex (including D2) is a prerequisite for association with core subunits like CP47 and CP43

When working with recombinant sugarcane D2, researchers should monitor not only the expression level but also the protein's ability to interact with other PSII components if functional studies are intended. Expression levels may need to be carefully regulated, as both insufficient and excessive production could negatively impact proper folding and assembly capabilities.

What expression systems are most suitable for recombinant sugarcane D2 protein production?

The choice of expression system for recombinant sugarcane D2 protein should be guided by experimental objectives and downstream applications. Based on published approaches with other photosynthetic proteins:

Expression SystemAdvantagesLimitationsRecommendations
E. coliHigh yield, rapid growth, economicalLack of photosynthetic machinery, poor membrane protein foldingUse specialized strains (C41/C43), lower temperature (16-18°C), fusion tags
CyanobacteriaNative photosynthetic machinery, natural cofactorsLower yield, longer growth timeIdeal for functional studies requiring physiological assembly
ChlamydomonasEukaryotic processing, chloroplast targetingComplex transformation, variable expressionGood for studying eukaryotic aspects of D2 processing
Plant cell culturesNative post-translational modificationsLow yield, slow growthBest for studying specific plant-related modifications

For researchers focused on structural studies, E. coli systems with specialized membrane protein expression capabilities represent the most practical approach, particularly when combined with solubilization tags and optimized growth conditions. For functional studies, photosynthetic hosts like cyanobacteria may provide more physiologically relevant expression environments despite lower yields.

How can researchers overcome the hydrophobic nature of D2 protein during recombinant expression?

The hydrophobic nature of D2 protein presents significant challenges during recombinant expression. Methodological approaches to address this include:

  • Fusion partners: Implement solubility-enhancing tags such as MBP (maltose-binding protein), SUMO, or Mistic protein, which can improve membrane protein solubility and expression levels.

  • Membrane-mimetic environments: Incorporate detergents (DDM, LMNG) or amphipols during or immediately after expression to provide a native-like lipid environment.

  • Temperature optimization: Lower expression temperatures (16-20°C) can reduce inclusion body formation and improve proper folding.

  • Specialized culture conditions: Implement methods such as:

    • Auto-induction media with gradually increasing expression

    • Osmotic stress adaptation (sorbitol, betaine supplementation)

    • Reduced IPTG concentrations (0.1-0.25 mM) with extended expression times

  • Co-expression strategies: Consider co-expressing molecular chaperones (GroEL/ES, DnaK) or other PSII components such as D1 that naturally interact with D2, potentially stabilizing its structure .

Monitoring expression through multiple experimental replicates and systematic variation of conditions is essential, as hydrophobic membrane proteins often require highly customized protocols.

What methods can determine if recombinant D2 protein retains native structure and function?

Confirming that recombinant sugarcane D2 protein maintains its native structure and function requires a multi-technique approach:

  • Structural assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure elements

    • Limited proteolysis to evaluate folding state (properly folded proteins often show characteristic resistance patterns)

    • Size exclusion chromatography to assess aggregation state and homogeneity

  • Functional analyses:

    • Binding assays with known interaction partners (D1, CP43)

    • Reconstitution experiments with other PSII components

    • Electron transfer measurements in reconstituted systems

  • Comparative approaches:

    • Thermal stability assays comparing recombinant vs. native D2

    • Antibody recognition patterns using conformation-specific antibodies

    • Ability to complement D2-deficient mutants in model systems

How do mutations in specific domains of D2 protein affect PSII assembly and function?

Research on D2 protein mutations provides valuable insights into structure-function relationships:

  • Transmembrane domain mutations:

    • The E69V mutation (glutamic acid to valine at position 69) leads to extreme instability or complete absence of D2 protein, preventing PSII assembly .

    • This indicates critical roles for specific residues in maintaining protein stability and assembly competence.

  • Loop region plasticity:

    • Studies in Synechocystis demonstrate that the stroma-exposed D-de loop of D2 can tolerate dramatic changes in composition and size without severe functional consequences .

    • Despite sequence alterations, maintaining the hydrophilic character and approximate positioning of turns in this loop appears sufficient for function .

  • Complete loss studies:

    • In D2-deficient mutants, other PSII proteins (D1, CP47, cytochrome b559) fail to form complexes despite being synthesized .

    • This confirms the sequential assembly pathway where D2 accumulation is a prerequisite for higher-order PSII assembly.

When designing experiments to study D2 mutants, researchers should consider the following methodological approaches:

  • Site-directed mutagenesis targeting conserved vs. variable regions

  • Complementation studies in D2-deficient backgrounds

  • Pulse-chase experiments to assess protein stability and turnover rates

  • Blue-native/SDS-PAGE to analyze complex formation

  • Time-resolved spectroscopy to evaluate electron transfer kinetics in functional mutants

What role does D2 protein play in PSII damage and repair mechanisms?

The D2 protein plays crucial roles in both PSII function and the regulation of damage-repair cycles:

  • Structural foundation: As a core component of PSII, D2 provides the structural framework necessary for proper assembly and function of the entire complex .

  • Co-regulation with D1: While D1 is often considered the primary target of photodamage and has a rapid turnover rate, D2 stability directly influences D1 turnover kinetics. In D2 mutants (E69V), D1 lifetime is drastically reduced to just minutes, with only a small fraction remaining stable for longer periods .

  • Assembly checkpoint: The accumulation of D2 represents a regulatory checkpoint in PSII assembly. Without proper D2 expression and accumulation, other components cannot assemble into functional complexes .

For researchers studying sugarcane D2 in the context of photodamage and repair, key methodological considerations include:

  • High-light stress experiments combined with protein synthesis inhibitors

  • Pulse-chase labeling to track protein turnover rates under various conditions

  • Immunoprecipitation studies to identify repair-associated interaction partners

  • Analysis of post-translational modifications that might regulate repair processes

  • Comparative studies of D2 sequences from species with different photosensitivity profiles

Understanding these mechanisms has practical implications for developing crops with enhanced photosynthetic efficiency and stress tolerance.

How can recombinant D2 protein be used to study PSII assembly pathways?

Recombinant sugarcane D2 protein provides a powerful tool for investigating PSII assembly pathways through several experimental approaches:

  • In vitro reconstitution studies:

    • Step-wise addition of purified components to assess assembly intermediates

    • Identification of minimal complex requirements

    • Evaluation of assembly kinetics under controlled conditions

  • Interaction mapping:

    • Pull-down assays to identify direct binding partners

    • Surface plasmon resonance or microscale thermophoresis to quantify binding affinities

    • Crosslinking mass spectrometry to capture transient interactions

  • Structural biology applications:

    • Cryo-EM studies of assembly intermediates

    • X-ray crystallography of subcomplexes

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamic regions

Evidence from cyanobacterial studies demonstrates that D2 accumulation represents a key regulatory step in PSII assembly . In mutants lacking D2, other PSII proteins fail to form complexes despite being synthesized, confirming that assembly proceeds through defined checkpoints . This sequential assembly model provides a framework for recombinant protein studies aimed at understanding species-specific aspects of PSII biogenesis in sugarcane.

What detection methods and antibodies are most effective for studying recombinant D2 protein?

Effective detection of recombinant sugarcane D2 protein requires appropriate methodology selection:

  • Antibody selection:

    • Global polyclonal antibodies like AS06 146 recognize D2 protein across multiple species

    • When working with tagged recombinant constructs, commercial antibodies against fusion tags (His, FLAG, GST) provide high sensitivity and specificity

    • For sugarcane-specific epitopes, custom antibodies may be necessary

  • Western blotting protocols:

    • Optimize protein extraction by normalizing to fresh weight

    • Use SDS-PAGE with 12-15% acrylamide concentration for optimal resolution

    • Transfer conditions: extended time (overnight) at lower voltage improves transfer efficiency for hydrophobic proteins

  • Alternative detection methods:

    • Mass spectrometry for label-free quantification and post-translational modification analysis

    • Fluorescence-based detection using tagged constructs for higher sensitivity

    • Thermal shift assays to monitor protein stability and folding state

Researchers should be aware that detection sensitivity can vary based on sample preparation, culture conditions, and protein expression levels. When PSII content is very low, detection challenges may arise independent of antibody quality .

What are the key control experiments when working with recombinant D2 protein?

Robust experimental design for recombinant sugarcane D2 protein research requires appropriate controls:

  • Expression and purification controls:

    • Empty vector controls processed identically to expression constructs

    • Wild-type protein expression alongside mutant variants

    • Native (non-recombinant) D2 preparations as reference standards

  • Functional validation controls:

    • Complementation assays in D2-deficient mutants like those described in Synechocystis

    • Parallel analysis of known functional and non-functional D2 variants

    • Competition assays with native D2 for binding partners or assembly factors

  • Specificity controls:

    • Pre-adsorption of antibodies with purified antigen

    • Analysis of cross-reactivity with related proteins (e.g., D1)

    • Negative controls lacking primary antibody in immunodetection

  • Environmental variables:

    • Control for light conditions during expression and purification

    • Temperature stability assessments

    • Buffer composition effects on protein stability and function

Researchers should systematically document these control conditions, as variations in experimental parameters can significantly impact recombinant D2 protein quality and functional characteristics.

How can researchers distinguish between properly folded and misfolded recombinant D2 protein?

Distinguishing properly folded from misfolded recombinant sugarcane D2 protein requires multiple analytical approaches:

  • Biochemical characterization:

    • Limited proteolysis: Properly folded proteins typically display characteristic resistance patterns

    • Detergent solubility profiles: Well-folded membrane proteins maintain solubility in milder detergents

    • Size exclusion chromatography: Misfolded proteins often form higher-order aggregates

  • Biophysical methods:

    • Circular dichroism spectroscopy: Assess secondary structure content

    • Intrinsic fluorescence: Monitor tertiary structure environment around aromatic residues

    • Differential scanning calorimetry: Evaluate thermal stability and folding cooperativity

  • Functional assessment:

    • Binding assays with known interaction partners (D1, CP43)

    • Assembly competence in reconstitution experiments

    • Electron transfer activity in reconstituted systems

  • Structural conformity:

    • Conformation-specific antibody recognition

    • Crosslinking patterns with neighboring proteins

    • Accessibility of specific residues to chemical modification

Studies of D2 mutants provide insight into functionally critical features. While some regions (like the D-de loop) can tolerate substantial changes , mutations in other domains (like E69V) completely destabilize the protein . This differential sensitivity can guide researchers in identifying critical folding determinants in recombinant sugarcane D2.

How might recombinant D2 protein studies contribute to improving photosynthetic efficiency?

Recombinant sugarcane D2 protein research offers several pathways to enhance photosynthetic efficiency:

  • Engineering stress-resistant variants:

    • Structure-guided mutagenesis targeting domains involved in photodamage

    • Screening for D2 variants with enhanced stability under high light or temperature stress

    • Development of chimeric proteins incorporating beneficial features from different species

  • Optimizing repair cycles:

    • Identifying rate-limiting steps in PSII repair through D2 interaction studies

    • Engineering D2 variants with altered degradation kinetics

    • Modifying D2-interacting proteins to enhance repair efficiency

  • Improving assembly pathways:

    • Characterizing assembly factors specific to sugarcane D2

    • Developing methods to accelerate PSII assembly under stress conditions

    • Identifying bottlenecks in D2 incorporation into functional PSII

The central role of D2 in PSII assembly and function makes it a promising target for photosynthetic engineering. Understanding how mutations affect both protein stability and complex assembly provides a foundation for rational design approaches to improve crop productivity under challenging environmental conditions.

What are the most promising approaches for structural studies of recombinant sugarcane D2?

Structural investigation of recombinant sugarcane D2 protein presents unique challenges requiring specialized approaches:

  • Membrane-mimetic environments:

    • Nanodiscs for native-like lipid bilayer incorporation

    • Amphipol stabilization for cryo-EM studies

    • Lipidic cubic phase crystallization for X-ray diffraction

  • Advanced imaging techniques:

    • Single-particle cryo-EM for structure determination without crystallization

    • Solid-state NMR for dynamic studies in membrane environments

    • Atomic force microscopy for topological and mechanical property assessment

  • Hybrid methods:

    • Integrative modeling combining low-resolution data with computational prediction

    • Cross-linking mass spectrometry to establish distance constraints

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • In silico approaches:

    • Molecular dynamics simulations to study conformational flexibility

    • Machine learning-based structure prediction leveraging known photosystem structures

    • Quantum mechanics/molecular mechanics modeling of electron transfer processes

Researchers should consider that while the D-de loop of D2 can tolerate significant sequence variation while maintaining function , other regions are highly sensitive to mutation , suggesting differential structural constraints across the protein that may influence experimental design choices.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.