Recombinant Sagiyama virus Structural polyprotein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Structural polyprotein; p130
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
816-1253
Protein Length
Full Length of Mature Protein
Species
Sagiyama virus (SAGV)
Target Protein Sequence
YEHTATIPNVVGFPYKAHIERNGFSPMTLQLEVLGTSLEPTLNLEYITCEYKTVVPPPYI KCCGASECRSMERPDYQCQVYTGVYPFMWGGAYCFCDTENTQLSEAYVDRSDVCKHDHAA AYKAHTAAMKATIRISYGNLNQTTTAFVNGEHTVTVGGSRFTFGPISTAWTPFDNKIVVY KNDVYNQDFPPYGSGQPGRFGDVQSRTVESKDLYANTALKLSRPSSGTVHVPYTQTPSGF KYWIKERGTSLNDKAPFGCVIKTNPVRAENCAVGNIPVSMDIPDSAFTRVIDAPAVTNLE CQVAVCTHSSDFGGIATLTFKTDKPGKCAVHSHSNVATIQEAAVDIKTDGKITLHFSTAS ASPAFMVSVCSAKTTCMAACEPPKDHIVPYGASHNNQVFPDMSGTAMTWVQRVAGGLGGL TLAAVAALILVTCVTMRR
Uniprot No.

Target Background

Function
The recombinant Sagiyama virus structural polyprotein forms an icosahedral capsid with T=4 symmetry, composed of 240 copies of the capsid protein. This capsid is surrounded by a lipid membrane, through which 80 spikes composed of E1-E2 heterodimer trimers protrude. The capsid protein binds to the viral RNA genome at a site adjacent to the ribosome binding site for viral genome translation following genome release. It possesses protease activity, resulting in its autocatalytic cleavage from the nascent structural protein. Following self-cleavage, the capsid protein transiently associates with ribosomes, and within minutes, binds to viral RNA and rapidly assembles into icosahedral core particles. The resulting nucleocapsid eventually associates with the cytoplasmic domain of the spike glycoprotein E2 at the cell membrane, leading to budding and the formation of mature virions. During infection, new virions attach to target cells and undergo clathrin-mediated endocytosis. Their membrane then fuses with the host endosomal membrane, releasing the nucleocapsid into the cytoplasm. This is followed by an uncoating event, essential for the genomic RNA to become accessible. Uncoating might be triggered by the interaction of capsid proteins with ribosomes. Binding of ribosomes could release the genomic RNA as the same region is involved in both genomic RNA binding and ribosome binding. The recombinant Sagiyama virus structural polyprotein specifically inhibits interleukin-1 receptor-associated kinase 1/IRAK1-dependent signaling during viral entry. This mechanism allows the alphaviruses to evade innate immune detection and activation before viral gene expression. The polyprotein also provides the signal sequence for the translocation of the E3/E2 precursor to the host endoplasmic reticulum. Furin-cleaved E3 remains associated with the spike glycoprotein E1, mediating pH protection of the latter during transport via the secretory pathway. After virion release from the host cell, the assembly protein E3 is gradually released in the extracellular space. The E2 glycoprotein plays a role in viral attachment to target host cells by binding to the cell receptor. It is synthesized as a p62 precursor, which is processed by furin at the cell membrane just before virion budding, generating the E2-E1 heterodimer. The p62-E1 heterodimer is stable, while E2-E1 is unstable and dissociates at low pH. p62 is processed in the final step, likely to prevent E1 fusion activation before its final export to the cell surface. The E2 C-terminus contains a transitory transmembrane domain that is disrupted by palmitoylation, resulting in the reorientation of the C-terminal tail from the lumenal to the cytoplasmic side. This step is critical because the E2 C-terminus is involved in budding by interacting with capsid proteins. This release of the E2 C-terminus in the cytoplasm occurs late in protein export and prevents premature assembly of particles at the endoplasmic reticulum membrane. The 6K protein is a constitutive membrane protein involved in virus glycoprotein processing, cell permeabilization, and the budding of viral particles. It disrupts the calcium homeostasis of the cell, likely at the endoplasmic reticulum level, leading to cytoplasmic calcium elevation. Due to its lipophilic properties, the 6K protein is thought to influence the selection of lipids that interact with the transmembrane domains of the glycoproteins. This, in turn, affects the deformability of the bilayer required for the extreme curvature that occurs during budding. It is present in low amounts in virions, about 3% compared to viral glycoproteins. The E1 glycoprotein is a class II viral fusion protein. Its fusion activity remains inactive as long as E1 is bound to E2 in the mature virion. After virus attachment to the target cell and endocytosis, acidification of the endosome induces dissociation of the E1/E2 heterodimer and concomitant trimerization of the E1 subunits. This E1 trimer is fusion-active and promotes the release of the viral nucleocapsid into the cytoplasm after endosome and viral membrane fusion. Efficient fusion requires the presence of cholesterol and sphingolipids in the target membrane. Fusion is optimal at levels of approximately 1 molecule of cholesterol per 2 molecules of phospholipids and is specific for sterols containing a 3-beta-hydroxyl group.
Subcellular Location
[Capsid protein]: Virion. Host cytoplasm. Host cell membrane. Host nucleus.; [Spike glycoprotein E2]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.; [6K protein]: Host cell membrane; Multi-pass membrane protein. Virion membrane; Multi-pass membrane protein.; [Spike glycoprotein E1]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What is the genomic structure of Sagiyama virus?

The Sagiyama virus genome consists of a single-stranded RNA molecule that is 11,698 nucleotides in length, excluding the 3' poly(A) tail. Complete nucleotide sequencing of both the original stock virus and a full-length cDNA clone (pSAG2) revealed nine amino acid differences between them: two each in the nonstructural proteins nsP1 and nsP2, two in envelope glycoprotein E1, and three in envelope glycoprotein E2 . These variations are believed to be responsible for the plaque phenotypic differences observed in the original virus stock, where mixed plaque sizes were identified compared to the uniform large plaques produced by the cDNA clone .

How does Sagiyama virus relate to other alphaviruses?

Comparative genomic analysis positions Sagiyama virus in close relationship to several other alphaviruses. It shares highest sequence homology with Ross River virus among fully sequenced alphaviruses, with amino acid sequence identities of 86% in nonstructural proteins and 83% in structural proteins . Interestingly, the 3' terminal 280 nucleotide region of SAG shows 82% identity to that of Barmah Forest virus, despite the latter not being closely related to SAG in other genomic regions . The high degree of nucleotide sequence similarity between SAG and Getah virus strongly supports the classification of SAG as a strain of GET rather than a distinct viral species .

How can the polyprotein strategy be applied to express Sagiyama virus proteins?

The polyprotein strategy, which has been successfully implemented for influenza virus polymerase expression, can be adapted for Sagiyama virus proteins. This approach involves designing a single open reading frame (ORF) containing multiple protein-coding sequences separated by protease cleavage sites . For effective implementation with Sagiyama virus:

  • Engineer a construct containing Sagiyama virus structural or nonstructural genes in a single ORF

  • Insert sequences encoding protease recognition sites (e.g., TEV protease sites) between protein-coding regions

  • Include reporter genes such as Cyan Fluorescent Protein (CFP) for monitoring expression levels

  • Co-express the protease for co-translational processing of the polyprotein

  • Optimize codon usage for the selected expression system (insect cells often yield better results for complex viral proteins)

  • Add affinity tags for downstream purification

This strategy enables stoichiometric production of multiple viral proteins in a single expression system, which is particularly valuable for structural studies of protein complexes .

What expression systems are optimal for recombinant Sagiyama virus polyprotein production?

Based on successful approaches with other viral polyproteins, insect cell expression systems represent the preferred platform for Sagiyama virus polyproteins. The MultiBac system has proven particularly effective for expressing complex viral protein assemblies . This baculovirus-based system offers several advantages:

  • Higher expression levels of complex eukaryotic proteins compared to bacterial systems

  • Proper post-translational modifications similar to mammalian cells

  • Capacity to express multiple proteins simultaneously

  • Ability to incorporate fluorescent reporters for monitoring expression (YFP in the baculovirus genome, CFP in the polyprotein)

  • Scalability for structural biology applications

For Sagiyama virus polyproteins, optimization of specific construct designs within this system would be necessary, particularly considering potential bottlenecks in expression similar to those observed with influenza virus PB2 protein .

What are the critical factors affecting recombinant polyprotein expression efficiency?

Several factors significantly impact the expression of recombinant viral polyproteins, as demonstrated in studies with influenza virus polymerase:

  • Protein domain boundaries: Careful selection of protein domain boundaries is crucial. In the influenza polymerase study, extending the PB2 component beyond residue 116 resulted in dramatically reduced expression levels .

  • Construct design parameters: The ratio of YFP (reporting virus performance) to CFP (reporting protein yield) serves as an effective metric for assessing construct quality. Higher ratios indicate expression problems - ratios around 15-17 indicate good expression, while ratios above 30 suggest significant expression limitations .

  • Protein solubility characteristics: Different construct designs show varying solubility in purification buffers, affecting final yield of functional protein .

Construct TypeTypical YFP/CFP RatioExpression Success
Heterodimers (optimal)4-6Excellent
Minimal core heterotrimers15-17Good
Extended heterotrimers28-50Poor/Failed

This quantitative approach to monitoring expression efficiency provides a systematic framework for optimizing Sagiyama virus polyprotein constructs .

What techniques are most effective for characterizing recombinant viral polyproteins?

The structural characterization of recombinant viral polyproteins requires a multi-technique approach:

For Sagiyama virus specifically, these approaches would need to be optimized based on the specific characteristics of its proteins.

How do molecular interactions within viral polyproteins affect their function?

Molecular interactions within viral polyproteins are critical determinants of their functional properties. Studies with influenza virus polymerase have revealed several key principles that may also apply to Sagiyama virus:

  • Subunit interactions create functional modules: The PA-PB1 heterodimer forms a stable submodule that can function independently for certain activities, such as binding to 5′-vRNA with sub-nanomolar affinity .

  • Complete functionality requires specific domain contributions: While the PA-PB1 heterodimer can bind 5′-vRNA, the specific recognition of 3′-vRNA depends on the PB2 N-terminal domain, demonstrating the specialized roles of different components .

  • Host factor interactions regulate function: The PA-PB1 complex forms a stable, stoichiometric complex with host nuclear import factor RanBP5, which prevents 5′-vRNA binding. This suggests a regulatory mechanism where nuclear transport processes control RNA binding activities .

  • Structural organization determines activity: The three polymerase subunits form intricate quaternary structures at vRNA promoter binding sites that are essential for proper function .

These principles highlight how the specific interactions between different components of the polyprotein and with host factors are critical for the coordination of viral replication and transcription processes.

What are the challenges in determining the structure of Sagiyama virus polyproteins?

Structural determination of Sagiyama virus polyproteins faces several significant challenges:

  • Expression limitations: As observed with influenza virus polymerase, certain viral protein domains may significantly limit expression yields. The identification of PB2 as a key bottleneck in influenza virus polymerase expression suggests that similar limitations might occur with Sagiyama virus proteins .

  • Construct optimization requirements: Extensive screening of multiple construct designs with varying domain boundaries is typically necessary to identify versions that express well and remain soluble. This process can be labor-intensive and time-consuming .

  • Complex assembly verification: Ensuring the correct assembly of multi-subunit complexes adds another layer of complexity to structural studies .

  • Protein stability issues: Maintaining the stability of purified complexes during concentration and crystallization attempts presents additional challenges .

  • Conformational heterogeneity: Viral polyproteins often exhibit multiple conformational states that can complicate structural determination efforts, particularly for crystallization-based approaches.

These challenges necessitate a systematic approach to construct design and expression optimization before structural characterization can be successfully undertaken.

How can structural studies of Sagiyama virus polyproteins inform antiviral development?

Structural studies of viral polyproteins provide crucial insights for antiviral drug development strategies:

  • Identification of functional domains: Detailed structural information reveals critical domains and interfaces that could serve as targets for small molecule inhibitors. For instance, understanding the interaction between the PA-PB1 heterodimer and vRNA could lead to the development of compounds that disrupt this binding .

  • Elucidation of host-virus interactions: The characterization of complexes between viral proteins and host factors, such as the PA-PB1-RanBP5 complex in influenza, identifies potential targets for drugs that disrupt these interactions .

  • Structural basis for existing resistance: Comparing structures of drug-resistant variants can explain the molecular basis of resistance and guide the design of next-generation inhibitors.

  • Structure-guided drug design: Detailed structural information enables rational, structure-based approaches to drug design rather than relying solely on high-throughput screening methods.

For Sagiyama virus specifically, structural studies could provide valuable insights into alphavirus replication mechanisms that might be applicable to related medically important alphaviruses like Chikungunya virus.

How can researchers overcome issues with protein solubility and stability?

Addressing solubility and stability challenges with viral polyproteins requires a multi-faceted approach:

  • Construct design optimization: Careful design of constructs based on bioinformatic analysis and available structural information is essential. For influenza virus polymerase, researchers tested multiple constructs with different boundaries to identify those with improved solubility properties .

  • Buffer optimization: The search for optimal buffer conditions can significantly impact protein stability. A typical starting buffer might contain 50 mM Tris-HCl pH 8.5, 300 mM NaCl, 2 mM β-mercaptoethanol, and 2–10% glycerol, with further optimization based on protein-specific requirements .

  • Fusion partners: Addition of solubility-enhancing tags, such as maltose-binding protein (MBP), can improve the expression and solubility of difficult proteins. In the influenza study, MBP fusion to PB2 proved beneficial for expression and solubility .

  • Co-expression approaches: Expressing proteins with their natural binding partners often enhances stability. For instance, co-expression of PA and PB1 formed a stable heterodimer that was more amenable to structural studies than individual proteins .

  • Limited proteolysis: For proteins that contain flexible regions causing instability, controlled proteolysis to remove these regions can improve sample homogeneity for structural studies.

Implementation of these strategies should be guided by systematic testing and characterization at each step of the optimization process.

What insights can comparative studies between Sagiyama virus and other alphaviruses provide?

Comparative studies between Sagiyama virus and other alphaviruses offer valuable perspectives:

These comparative approaches contribute to a deeper understanding of alphavirus biology that extends beyond any single virus species and may reveal conserved mechanisms that could serve as broad-spectrum antiviral targets.

How can researchers identify and overcome expression bottlenecks?

Identifying and addressing expression bottlenecks requires systematic investigation:

  • Fluorescent reporter monitoring: The use of fluorescent reporters like CFP within the polyprotein and YFP in the baculovirus provides quantitative metrics for expression efficiency. The YFP/CFP ratio serves as a sensitive indicator of expression problems - higher ratios (above 20-30) suggest significant bottlenecks .

  • Truncation series analysis: Creating a series of truncated constructs can identify problematic domains. In the influenza polymerase study, researchers determined that extending PB2 beyond residue 116 dramatically reduced expression levels .

  • Western blot analysis: Monitoring protein expression by western blotting with specific antibodies can pinpoint which components of a polyprotein are limiting expression. As seen with influenza polymerase, reduced PB2 expression led to decreased levels of all components .

  • Domain-by-domain approach: When full complexes prove difficult to express, focusing on stable subcomplexes (like the PA-PB1 heterodimer in influenza) can provide valuable structural and functional insights while work continues on the complete assembly .

  • Alternative expression systems: If insect cell expression yields poor results, mammalian or cell-free expression systems may be worth exploring, particularly for problematic protein domains.

Implementation of these approaches requires patience and systematic testing but can ultimately overcome seemingly intractable expression challenges.

What is the optimal workflow for purifying recombinant Sagiyama virus polyproteins?

Based on successful approaches with other viral polyproteins, an optimal purification workflow would include:

  • Initial capture: Affinity chromatography using tags incorporated in the construct design (typically His-tags) for initial capture from cell lysates .

  • Tag removal: Proteolytic removal of affinity tags if they might interfere with downstream structural studies, using the same protease (e.g., TEV) employed for polyprotein processing.

  • Intermediate purification: Ion exchange chromatography to separate the target proteins from contaminants based on charge differences.

  • Polishing: Size exclusion chromatography to isolate properly assembled complexes and remove aggregates or incomplete assemblies.

  • Quality control: Analytical techniques such as dynamic light scattering, mass spectrometry, and SDS-PAGE to verify sample purity and homogeneity.

Throughout this process, maintaining protein stability with optimized buffers is essential. A starting buffer containing 50 mM Tris-HCl pH 8.5, 300 mM NaCl, 2 mM β-mercaptoethanol, and 2–10% glycerol has proven effective for various viral polyprotein constructs , though optimization for Sagiyama virus proteins would be necessary.

How can researchers validate the functional integrity of purified recombinant polyproteins?

Functional validation of purified recombinant viral polyproteins involves several complementary approaches:

  • RNA binding assays: For viral polymerases and RNA-binding proteins, assessment of interaction with viral RNA elements is crucial. The influenza polymerase studies demonstrated that the PA-PB1 heterodimer binds 5′-vRNA with high affinity, while 3′-vRNA binding requires the PB2 N-terminal domain .

  • Enzymatic activity assays: For proteins with enzymatic functions, such as the RNA-dependent RNA polymerase activity of alphavirus nonstructural proteins, direct measurement of catalytic activity provides the most definitive functional validation.

  • Host factor interaction studies: Assessing interaction with relevant host factors can provide important functional insights. The formation of a stable complex between PA-PB1 and RanBP5 in influenza studies demonstrated preservation of biologically relevant binding interfaces .

  • Conformational analysis: Techniques such as limited proteolysis, thermal shift assays, or hydrogen-deuterium exchange mass spectrometry can assess whether the purified proteins adopt the expected folded conformations.

  • Electron microscopy: Negative-stain or cryo-electron microscopy can verify the structural integrity of larger complexes and provide evidence that the recombinant proteins assemble as expected.

These complementary approaches collectively provide robust validation of functional integrity beyond simple purity assessments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.