Recombinant Saguinus fuscicollis Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate your specific requirements. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is dependent on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Saguinus fuscicollis (Brown-headed tamarin)
Target Names
Target Protein Sequence
MPMQGAHRKLLGSLNSTPTATSNLGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLETAVILLLEAGALATRTSVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAIAAIWVASVLSSTLFI TYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAHGIIRLHKRQSPAHQGFGLRGA ATLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCSCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRTLKEVLCSW
Uniprot No.

Target Background

Function
This receptor acts as a binding site for melanocyte-stimulating hormone (MSH) subtypes (alpha, beta, and gamma) and adrenocorticotropic hormone (ACTH). Its activity is regulated by G proteins, which activate adenylate cyclase. MC1R plays a crucial role in melanogenesis, the process of producing eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of MC1R in Saguinus fuscicollis compared to other primates?

The functional divergence of MC1R in Saguinus fuscicollis would likely be evolutionarily significant, as studies in Sulawesi macaques have demonstrated that fixed species-specific MC1R variants exhibit divergent basal activity and agonist-induced cAMP performance compared to ancestral sequences . For researchers investigating this receptor, it is essential to perform comparative sequence analyses against human and other primate MC1R sequences, followed by functional cAMP assays to determine both basal activity and response to agonists like α-MSH.

How should researchers interpret MC1R variant classification when studying non-human primates?

When investigating MC1R variants in Saguinus fuscicollis or other non-human primates, researchers should be cautious about directly applying the human-derived 'R' and 'r' variant classification system. In humans, variants like D84E, R142H, R151C, I155T, R160W, and D294H are classified as high-penetrance 'R' variants that significantly impair receptor function, while other non-synonymous variants are classified as low-penetrance 'r' variants with milder effects .

For non-human primate studies, researchers should implement a stepwise approach:

  • Sequence the complete MC1R coding region using primers targeting conserved regions, similar to those used in human studies (e.g., MC1R-F1: 5'-CAG CAC CAT GAA CTA AGC AGG ACA CCT G-3'; MC1R-R1: 5'-CCA GCA TAG CCA GGA AGA AGA CCA CGA G-3')

  • Identify non-synonymous variants and assess their conservation across species

  • Perform functional assays to determine the actual impact on receptor signaling rather than assuming functional effects based on human classifications

  • Consider using bioinformatic prediction tools like SIFT and PolyPhen to assess potential functional impacts, but validate these predictions experimentally

What expression systems are most appropriate for recombinant Saguinus fuscicollis MC1R production?

For successful expression of functional recombinant Saguinus fuscicollis MC1R, researchers should consider several expression systems, each with distinct advantages:

Mammalian Cell Expression Systems:
These provide the most physiologically relevant post-translational modifications and membrane insertion for G protein-coupled receptors like MC1R. Based on established protocols for MC1R functional studies, HEK293 cells are particularly effective for recombinant MC1R expression when evaluating cAMP production . The system should include:

  • A mammalian expression vector containing a strong promoter (CMV)

  • The complete coding sequence of Saguinus fuscicollis MC1R

  • Selection markers for stable transfection if long-term expression is desired

  • Control vectors expressing well-characterized MC1R variants (e.g., human wild-type)

Insect Cell/Baculovirus Systems:
For higher protein yields while maintaining most post-translational modifications, Sf9 or High Five insect cells can be utilized with baculovirus vectors containing the MC1R sequence.

For all expression systems, researchers should verify receptor expression through Western blotting and immunofluorescence before proceeding to functional studies. Importantly, species-specific variants in MC1R may affect expression efficiency and function, as demonstrated in studies of macaque MC1R .

How can researchers design comprehensive functional characterization studies for Saguinus fuscicollis MC1R?

Comprehensive functional characterization of Saguinus fuscicollis MC1R requires a multi-parameter approach that extends beyond basic expression analysis. Based on established protocols from MC1R studies in other species, researchers should implement the following methodology:

cAMP Signaling Assays:

  • Establish dose-response relationships using a range of α-MSH concentrations (typically 10^-12 to 10^-6 M)

  • Measure both basal (constitutive) and agonist-induced cAMP production

  • Calculate EC50 values to determine binding affinity and efficacy

  • Compare results with control receptors (e.g., human MC1R or other primate MC1Rs)

The interpretation of results should consider that MC1R exhibits agonist-independent constitutive signaling that varies across species, as observed in Sulawesi macaques where signaling strength differed significantly between species (p < 0.05, BH-adjusted) .

Binding Affinity Studies:
Researchers should perform competitive binding assays using radiolabeled or fluorescently labeled MSH analogs to determine:

  • Binding affinity (Ki values)

  • Association and dissociation kinetics

  • Ligand selectivity across different melanocortin peptides

Table 1: Expected Parameters for MC1R Functional Characterization

ParameterMeasurement MethodExpected Range (Based on Primate Studies)Notes
Basal cAMP ActivityIn vitro cAMP assay0.2-0.4 ΔFF (relative to control)May vary substantially between species
EC50 for α-MSHDose-response curve0.3-3.0 nMHigher values indicate reduced sensitivity
Ligand Binding AffinityCompetitive bindingKi: 1-20 nMCan vary by receptor variant
Receptor ExpressionFlow cytometry/Western blotN/AQuantify relative to control receptors

What approaches can identify key residues responsible for functional differences in Saguinus fuscicollis MC1R?

To identify critical amino acid residues that contribute to the unique functional properties of Saguinus fuscicollis MC1R, researchers should implement a systematic mutagenesis approach informed by evolutionary analysis. Based on successful identification of functional residues in other MC1R studies, the following methodology is recommended:

  • Comparative Sequence Analysis:

    • Align MC1R sequences from Saguinus fuscicollis with those from closely related species and human MC1R

    • Identify species-specific substitutions, particularly those in transmembrane domains or ligand-binding regions

    • Prioritize residues based on conservation scores and predicted functional impacts

  • Site-Directed Mutagenesis:

    • Generate single-point mutants focusing on species-specific residues

    • Create reciprocal mutations (changing Saguinus-specific residues to human equivalents and vice versa)

    • Include multiple mutation constructs to test combined effects

  • Functional Testing:

    • Assess each mutant for changes in basal activity and agonist response using cAMP assays

    • Measure cell surface expression to distinguish between trafficking defects and intrinsic functional changes

This approach successfully identified key functional residues in studies of Sulawesi macaque MC1Rs, where specific mutations like Y267C in M. hecki MC1R rescued the binding affinity to α-MSH, while P153H in M. maurus MC1R significantly reduced basal cAMP production . Results should be analyzed for statistically significant differences in cAMP production and EC50 values between wild-type and mutant receptors.

How can researchers effectively investigate MC1R evolution across primate lineages including Saguinus fuscicollis?

Investigating MC1R evolution across primate lineages requires a multidisciplinary approach combining molecular phylogenetics, population genetics, and functional analyses. Based on successful evolutionary studies of MC1R in macaques, researchers should:

  • Sequence MC1R from Multiple Individuals:

    • Sample multiple individuals from Saguinus fuscicollis and related tamarin species

    • Use consistent primer sets targeting conserved regions flanking the MC1R coding sequence

    • Assess within-species variability and between-species divergence

  • Perform Selection Analysis:

    • Calculate dN/dS ratios to detect signals of selection

    • Apply site-specific models to identify particular codons under selection

    • Use branch-site models to detect episodic selection on specific lineages

  • Correlate Genetic Variation with Phenotype:

    • Document coat color patterns across sampled individuals

    • Analyze associations between specific variants and pigmentation phenotypes

    • Consider environmental factors that might influence selection pressure

Studies of Sulawesi macaques found that MC1R in M. nigra and M. nigrescens underwent purifying selection, despite their dark coat color . This counter-intuitive finding highlights the importance of functional validation beyond sequence analysis. For Saguinus fuscicollis, researchers should be prepared to encounter similar complexity in the relationship between MC1R sequence variation and coat color phenotypes.

What are the optimal controls and validation methods for functional studies of recombinant Saguinus fuscicollis MC1R?

Robust experimental design for functional studies of recombinant Saguinus fuscicollis MC1R requires carefully selected controls and validation methods to ensure reliable results. Based on established protocols in MC1R research, implementation should include:

Essential Controls:

  • Positive Control: Expression of a well-characterized MC1R (e.g., M. nemestrina MC1R has been used as a positive control in studies of macaque MC1R, exhibiting high basal activity and dose-dependent response to α-MSH)

  • Negative Controls:

    • Empty vector transfection to assess background cAMP levels

    • Expression of known non-functional MC1R variants

    • Untransfected cells to establish baseline measurements

  • Internal Controls:

    • Co-expression of a constitutively active luciferase for normalization

    • Expression of human MC1R variants with known functional characteristics

Validation Methods:

  • Expression Verification:

    • Western blotting with anti-MC1R antibodies

    • Cell surface ELISA or flow cytometry to confirm membrane localization

    • Immunofluorescence microscopy to visualize receptor distribution

  • Functional Validation:

    • Concordance between multiple cAMP detection methods (e.g., ELISA, FRET-based sensors)

    • Reproducibility across independent transfections (minimum n=3)

    • Dose-response relationship with known agonists

The experimental design should include statistical planning with power analysis to determine appropriate sample sizes for detecting meaningful differences between variants, particularly when performing comparative analyses across species or when studying subtle functional effects of specific residues.

What methodological considerations are important when designing cAMP assays for MC1R functional analysis?

cAMP assays are central to characterizing MC1R function, as this receptor primarily signals through Gαs-mediated cAMP production. When designing these assays for Saguinus fuscicollis MC1R, researchers should consider several critical methodological factors:

Assay Selection and Optimization:

  • Assay Format:

    • FRET/BRET-based real-time cAMP sensors provide temporal resolution

    • ELISA-based methods offer high sensitivity for endpoint measurements

    • Radioimmunoassays remain a gold standard but have safety considerations

  • Cell Density and Transfection Optimization:

    • Standardize cell number (typically 2-5 × 10^4 cells/well for 96-well formats)

    • Determine optimal DNA:transfection reagent ratios

    • Allow sufficient expression time (24-48 hours post-transfection)

  • Stimulation Parameters:

    • Pre-incubate with phosphodiesterase inhibitors (e.g., IBMX at 0.5 mM)

    • Use freshly prepared α-MSH solutions at concentrations ranging from 10^-12 to 10^-6 M

    • Standardize stimulation time (typically 15-30 minutes for peak response)

Studies of MC1R in macaques successfully employed these methods to identify significant differences in basal cAMP levels, with values compared to positive control cells and statistically analyzed using pairwise t-tests (P < 0.05, BH-adjusted) .

Data Analysis Protocols:

  • Calculate fold change in cAMP levels relative to basal conditions

  • Determine EC50 values through nonlinear regression analysis

  • Compare parameters across variants using appropriate statistical tests

  • Present data as both absolute values and normalized to control receptor function

How should researchers approach the analysis of MC1R variant effects on pigmentation in Saguinus fuscicollis?

Establishing connections between MC1R variants and pigmentation phenotypes in Saguinus fuscicollis requires a comprehensive experimental design that accounts for both genetic and environmental factors. Based on human and macaque studies, researchers should implement:

Genotype-Phenotype Correlation Methodology:

  • Phenotype Documentation:

    • Standardized photography of coat color patterns

    • Quantitative color measurements using colorimeters or digital image analysis

    • Histological analysis of hair samples for eumelanin/pheomelanin ratios

  • Genetic Analysis:

    • Complete MC1R sequencing with attention to both coding and regulatory regions

    • Consideration of additional pigmentation genes (e.g., ASIP, TYR, TYRP1)

    • Population-level sampling to assess variant frequency

  • Statistical Approaches:

    • Logistic regression models to determine odds ratios for phenotype association

    • Adjustment for environmental factors when applicable

    • Multiple testing correction for genotype-phenotype associations

How should researchers interpret contradictory results in MC1R functional studies?

Contradictory results in MC1R functional studies are not uncommon, particularly when comparing across species or methodologies. When encountering such discrepancies, researchers should implement a systematic approach to interpretation:

Methodological Reconciliation Strategy:

  • Standardize Experimental Conditions:

    • Compare expression levels between studies

    • Ensure consistent cell lines, passage numbers, and transfection efficiency

    • Normalize results to appropriate internal controls

  • Consider Receptor-Specific Mechanisms:

    • Differentiate between effects on basal activity versus agonist-induced responses

    • Assess potential for biased signaling through alternate pathways

    • Evaluate receptor desensitization and internalization dynamics

  • Resolve Apparent Contradictions:

    • In studies of Sulawesi macaques, MC1R variants in dark-coated species unexpectedly showed decreased basal activity . This apparent contradiction was resolved through comprehensive analysis of both constitutive and agonist-induced signaling.

    • Consider that MC1R may have pleiotropic effects beyond melanogenesis, including potential roles in DNA damage repair .

Decision Framework for Contradictory Data:

When functional data seems inconsistent with phenotypic observations:

  • Investigate the involvement of other pigmentation genes

  • Consider epistatic interactions between MC1R and other pathway components

  • Evaluate the possibility of compensatory mechanisms

  • Assess whether experimental conditions might not reflect the in vivo environment

What bioinformatic approaches are most valuable for comparative analysis of MC1R across primates?

Comparative analysis of MC1R across primates requires sophisticated bioinformatic approaches to extract meaningful evolutionary and functional insights. Based on successful analytical frameworks in MC1R research, researchers should employ:

Sequence Analysis Methodology:

  • Multiple Sequence Alignment:

    • Use progressive alignment algorithms (e.g., MUSCLE, MAFFT)

    • Include diverse primate species spanning major evolutionary lineages

    • Anchor alignments with highly conserved transmembrane domains

  • Evolutionary Analysis:

    • Construct phylogenetic trees using maximum likelihood or Bayesian approaches

    • Calculate selective pressure (dN/dS) across the entire gene and at specific sites

    • Identify lineage-specific acceleration or constraint

  • Structural Prediction:

    • Generate homology models based on crystal structures of related GPCRs

    • Map species-specific substitutions onto 3D models

    • Predict functional impacts using tools like SIFT and PolyPhen

Data Integration Framework:

  • Link sequence variation to functional data from cAMP assays

  • Correlate structural predictions with experimental mutagenesis results

  • Integrate pigmentation phenotypes across the primate phylogeny

This approach has successfully identified variants with functional significance in human populations, where specific MC1R variants have been associated with red hair phenotype and melanoma risk . When applied to non-human primates like Saguinus fuscicollis, these methods can reveal evolutionary adaptations specific to different ecological niches.

How can researchers effectively translate findings from MC1R studies across different species?

Translating findings from MC1R studies across species requires careful consideration of both evolutionary conservation and species-specific adaptations. To effectively apply knowledge gained from one species (e.g., humans or macaques) to studies of Saguinus fuscicollis MC1R, researchers should implement:

Cross-Species Translation Framework:

  • Identify Conserved Elements:

    • Functionally critical domains typically show high conservation

    • Key ligand-binding residues often maintain their positions

    • Signaling motifs necessary for G-protein coupling tend to be preserved

  • Map Species-Specific Differences:

    • Residues under positive selection may indicate adaptive functions

    • Lineage-specific insertions or deletions require special attention

    • Consider potential compensatory mutations that maintain function

  • Validate Functional Predictions:

    • Test predicted functional impacts through reciprocal mutagenesis

    • Compare dose-response relationships across species

    • Verify that classification systems (e.g., 'R' and 'r' variants) are applicable

The challenge in translating findings is exemplified by studies of macaque MC1R, where species with dark coat colors unexpectedly had MC1R variants with decreased basal activity . This highlights that the relationship between MC1R function and pigmentation can differ across evolutionary lineages, necessitating direct experimental validation rather than assumption-based translation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.