Recombinant Saguinus geoffroyi Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will do our best to fulfill it.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses and avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We will select the appropriate tag type during production. If you have a specific tag requirement, please inform us and we will prioritize development according to your specifications.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Saguinus geoffroyi (Geoffroy's tamarin)
Target Names
Target Protein Sequence
MPMQGAQRKLLGSLNSTPTATSNLGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLETAVILLLETGALATRTSVVQQLHNTI NVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAIAAIWVASVLSSTLFI TYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAHGIIRLHKRQTPAHQAFGLRGA ATLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCSCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRTLKEVLCSW
Uniprot No.

Target Background

Function
This receptor binds to alpha, beta, and gamma MSH and ACTH. Its activity is mediated by G proteins that stimulate adenylate cyclase. Through regulating cAMP signaling in melanocytes, it plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow).
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of the MC1R protein in Saguinus geoffroyi?

The MC1R (Melanocyte-stimulating hormone receptor) in Saguinus geoffroyi (Geoffroy's tamarin) is a Class A (Rhodopsin) G protein-coupled receptor belonging to the melanocortin receptor family . It consists of 310 amino acids with the characteristic seven-transmembrane domain structure (TM1-TM7) typical of GPCRs, along with three intracellular loops (ICL1-3), three extracellular loops (ECL1-3), and a C-terminal helix 8 . The receptor features an N-terminal extracellular domain of approximately 40 amino acids and a C-terminal intracellular domain following the conserved helix 8 structure . Functionally, MC1R primarily responds to melanocyte-stimulating hormone (MSH), regulating melanogenesis and pigmentation processes in primates through activation of adenylyl cyclase and subsequent cAMP-dependent signaling pathways.

How does the amino acid sequence of MC1R in Saguinus geoffroyi compare to other primate species?

The MC1R protein sequence in Saguinus geoffroyi shares significant homology with MC1R proteins from other primate species, particularly within the Callitrichidae family. When compared to the golden-headed lion tamarin (Leontopithecus chrysomelas) MC1R, the Geoffroy's tamarin receptor displays high sequence similarity, especially in the transmembrane domains and critical ligand-binding regions . Sequence alignment reveals that the most highly conserved regions include the DRY motif in TM3 (amino acids 141-143 in S. geoffroyi), which is essential for G-protein coupling, and portions of TM5-7 that form the binding pocket . The N-terminal domains show greater variability between species, potentially reflecting differences in ligand recognition or regulatory mechanisms. Notable differences in key extracellular loop regions may account for species-specific responses to melanocortin peptides.

What expression systems are commonly used for producing recombinant Saguinus geoffroyi MC1R?

Escherichia coli is a commonly used expression system for producing recombinant Saguinus geoffroyi MC1R, especially for structural studies requiring high protein yields . For functional studies requiring proper post-translational modifications, mammalian expression systems like HEK293 or CHO cells are preferred as they provide the appropriate cellular machinery for correct folding and membrane insertion of this GPCR. Insect cell systems (Sf9 or High Five) using baculovirus vectors represent an intermediate option, offering some post-translational modifications with potentially higher yields than mammalian systems. When using E. coli expression systems, the addition of fusion partners like thioredoxin or MBP, along with N-terminal His-tags for purification, can improve protein solubility and yield . Codon optimization for the expression host and use of specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) can significantly improve the quality and quantity of recombinant MC1R production.

What are the optimal storage conditions for recombinant Saguinus geoffroyi MC1R protein?

Recombinant Saguinus geoffroyi MC1R protein is optimally stored as a lyophilized powder at -20°C to -80°C for long-term stability . For working solutions, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) to prevent freeze-thaw damage . Reconstituted protein should be aliquoted to avoid repeated freeze-thaw cycles, which can significantly compromise structural integrity and functional activity . For short-term storage (up to one week), working aliquots can be maintained at 4°C in appropriate buffers, such as Tris/PBS-based buffer at pH 8.0 containing stabilizers like 6% trehalose . When handling the protein, centrifuge the vial briefly before opening to ensure all material is at the bottom, and implement strict temperature control during all manipulation steps to prevent protein degradation.

What are the key methodological considerations when designing ligand-binding assays for recombinant Saguinus geoffroyi MC1R?

When designing ligand-binding assays for recombinant Saguinus geoffroyi MC1R, researchers must first consider the membrane environment, as this GPCR requires proper lipid composition for maintaining native conformation and function. Reconstitution in nanodiscs or liposomes with defined lipid compositions can provide a more physiologically relevant environment compared to detergent micelles. Radioligand binding assays using 125I-labeled α-MSH or NDP-α-MSH derivatives remain the gold standard for quantitative binding studies, though fluorescence-based alternatives using fluorescently labeled ligands are increasingly popular for their safety and convenience. Competition binding assays should include appropriate positive controls, such as known MC1R ligands, and negative controls like unrelated peptides, to validate assay specificity and receptor functionality.

Buffer composition significantly impacts binding outcomes, with optimal conditions typically including 25-50 mM Tris-HCl (pH 7.4), 1 mM CaCl2, 5 mM MgCl2, and 0.1% BSA to minimize non-specific binding. For functional assays, cAMP accumulation measurements using ELISA or HTRF-based methods provide valuable insights into receptor activation, while β-arrestin recruitment assays can reveal biased signaling properties of different ligands. Temperature control during binding experiments is crucial, with 25°C often representing a good compromise between binding kinetics and protein stability, though species-specific optimization may be required for Saguinus geoffroyi MC1R.

How can we optimize protein yield and stability when expressing Saguinus geoffroyi MC1R in E. coli systems?

Optimizing protein yield and stability for Saguinus geoffroyi MC1R expression in E. coli begins with vector selection, where low-copy plasmids with tunable promoters (like the pET series with T7lac promoters) allow for controlled expression to prevent toxic accumulation. Strategic placement of affinity tags is critical, with N-terminal tags generally preferred for MC1R to avoid interference with C-terminal signaling domains, though the impact of tag position on protein folding should be empirically determined. Fusion partners like thioredoxin (TrxA) or maltose-binding protein (MBP) can dramatically improve membrane protein solubility, while inclusion of a TEV or PreScission protease cleavage site enables tag removal after purification.

Expression conditions should be systematically optimized, starting with lower temperatures (16-20°C) after induction to slow protein production and improve folding, combined with reduced IPTG concentrations (0.1-0.5 mM) to prevent overwhelming the bacterial translocation machinery. Media supplementation with specific additives can enhance MC1R stability, including glycerol (5-10%) to stabilize hydrophobic domains, specific metal ions that interact with the receptor, or ligands that stabilize particular conformational states. Specialized E. coli strains like C41(DE3), C43(DE3), or Lemo21(DE3) are engineered for membrane protein expression and can significantly improve yields through modified membrane biogenesis pathways and reduced toxicity responses.

What are the most reliable methods for validating the functional integrity of recombinant Saguinus geoffroyi MC1R after purification?

Validating the functional integrity of recombinant Saguinus geoffroyi MC1R after purification requires a multi-faceted approach beginning with structural assessment via circular dichroism (CD) spectroscopy to confirm the characteristic α-helical content expected for a seven-transmembrane GPCR. Thermal shift assays provide insights into protein stability under various buffer conditions, with properly folded MC1R showing cooperative unfolding transitions that can be monitored by differential scanning fluorimetry. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can verify monodispersity and appropriate oligomeric state, as aggregated or improperly folded receptor will show aberrant elution profiles and molecular weight distributions.

Ligand binding capacity represents the most direct functional validation, ideally using a radioligand binding assay with a well-characterized melanocortin peptide like [125I]-NDP-α-MSH to determine if the purified receptor maintains its native binding affinity (typically in the nanomolar range for α-MSH derivatives). For additional functional validation, reconstitution of purified MC1R into proteoliposomes or nanodiscs followed by G protein coupling assays using purified G protein subunits can demonstrate signal transduction capability. Surface plasmon resonance (SPR) or microscale thermophoresis (MST) provides label-free alternatives for measuring binding kinetics and affinities, which should be comparable to values reported for native receptor when the recombinant protein is properly folded and functional.

How do different tag systems affect the structural integrity and binding properties of recombinant Saguinus geoffroyi MC1R?

Different tag systems can significantly impact the structural integrity and binding properties of recombinant Saguinus geoffroyi MC1R through various mechanisms related to protein folding, stability, and accessibility of functional domains. Polyhistidine tags (His6 or His10) are commonly employed for their small size and minimal impact on protein structure, though they may occasionally interact with metal-binding sites within the receptor or affect local charge distribution . Larger fusion partners like maltose-binding protein (MBP) or glutathione S-transferase (GST) can substantially improve solubility and expression yields but may sterically hinder ligand access to binding pockets or interfere with receptor oligomerization if not removed before functional studies.

The position of the tag relative to the MC1R sequence is often more critical than the tag identity itself, with N-terminal tags generally preferred for GPCRs to avoid disrupting the critical C-terminal region involved in G protein coupling and intracellular signaling. Flag, HA, or c-Myc epitope tags offer advantages for immunodetection with minimal structural impact, making them valuable for localization studies and quality control during expression and purification. Fluorescent protein tags like GFP can serve dual purposes for detection and folding assessment (as GFP fluorescence typically indicates proper folding of the fusion partner), though their large size may affect receptor trafficking or ligand binding kinetics.

What approaches can be used to study conformational changes in Saguinus geoffroyi MC1R upon ligand binding?

Advanced biophysical techniques provide powerful approaches for studying conformational changes in Saguinus geoffroyi MC1R upon ligand binding. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map regions of altered solvent accessibility following ligand binding, revealing which domains undergo conformational rearrangements during receptor activation. Site-directed fluorescence labeling, particularly using environment-sensitive fluorophores at strategically selected residues near the binding pocket or intracellular G protein coupling interface, can detect local conformational changes through shifts in fluorescence intensity or wavelength upon ligand addition. Resonance energy transfer techniques, including FRET and BRET, offer dynamic measurement capabilities when donor and acceptor fluorophores or bioluminescent proteins are incorporated at positions that change in relative distance or orientation during the activation process.

Double electron-electron resonance (DEER) spectroscopy combined with site-directed spin labeling provides precise distance measurements between selected residues, enabling researchers to track nanoscale movements within the transmembrane helices upon agonist binding. Cysteine accessibility methods, where strategically introduced cysteine residues are probed for reactivity with thiol-specific reagents before and after ligand binding, can identify regions that become more exposed or buried during activation. X-ray crystallography or cryo-electron microscopy (cryo-EM), though technically challenging for GPCRs, represent gold standard approaches for capturing high-resolution snapshots of the MC1R in different conformational states, potentially revealing the molecular details of the activation mechanism in unprecedented detail.

How can we develop selective peptide antagonists for Saguinus geoffroyi MC1R for structure-function studies?

Developing selective peptide antagonists for Saguinus geoffroyi MC1R begins with examining the natural melanocortin peptide sequence (His-Phe-Arg-Trp) and introducing systematic modifications to convert agonist activity to antagonist properties. Alanine scanning mutagenesis of known melanocortin peptides identifies critical residues for receptor binding versus activation, with replacement of key pharmacophore residues often converting agonists to antagonists while maintaining binding affinity. Structure-guided design utilizing homology models based on crystallized GPCRs, particularly those within the melanocortin receptor family, can highlight key receptor-ligand interaction points for targeted modification to disrupt the activation mechanism while preserving binding.

Incorporation of D-amino acids or N-methylated residues often transforms melanocortin peptides from agonists to antagonists by altering backbone conformation while maintaining side-chain interactions. Cyclic constraint strategies, using disulfide bridges or other cyclization chemistries, can lock peptides into conformations that bind the receptor but fail to trigger the conformational changes necessary for activation. Phage display or mRNA display technologies offer high-throughput screening approaches for identifying novel peptide sequences with selective antagonist properties against Saguinus geoffroyi MC1R when tested against a panel of related melanocortin receptors from various species.

What computational models are most effective for predicting ligand interactions with Saguinus geoffroyi MC1R?

For predicting ligand interactions with Saguinus geoffroyi MC1R, homology modeling combined with molecular dynamics (MD) simulations provides the most comprehensive computational approach. Homology models should be constructed using multiple templates, prioritizing recently solved high-resolution structures of Class A GPCRs, particularly those within the melanocortin receptor family if available, while incorporating specific sequence features of the Saguinus geoffroyi receptor. MD simulations with explicit membrane and solvent environments are critical for refining these models, typically requiring microsecond-scale simulations to adequately sample the conformational space and capture the dynamic nature of GPCR-ligand interactions.

Enhanced sampling techniques such as metadynamics or accelerated MD prove valuable for exploring the energy landscape of MC1R-ligand binding, overcoming energy barriers that might be inaccessible in standard simulations. Fragment-based computational screening approaches, where small chemical fragments are docked into potential binding sites before being linked into larger compounds, can identify novel interaction patterns specific to the Saguinus geoffroyi MC1R binding pocket. Machine learning methods, particularly deep neural networks trained on existing GPCR-ligand interaction data and augmented by physics-based scoring functions, are increasingly effective for predicting binding affinities and identifying subtle species-specific binding preferences.

How can we develop cell-based assays to investigate Saguinus geoffroyi MC1R signaling pathways?

Developing cell-based assays for Saguinus geoffroyi MC1R signaling pathways requires careful consideration of cellular background and reporter systems. CRISPR/Cas9-mediated knockout of endogenous melanocortin receptors in mammalian cell lines (HEK293 or CHO) provides clean backgrounds for expressing the Saguinus geoffroyi MC1R without interference from related receptors. Bioluminescence resonance energy transfer (BRET)-based biosensors enable real-time monitoring of MC1R-induced conformational changes in downstream effectors like G proteins (typically Gαs for MC1R) or β-arrestins, offering insights into both activation kinetics and signal magnitude.

Transcriptional reporters utilizing cAMP-responsive elements (CRE) driving luciferase or fluorescent protein expression provide integrated readouts of downstream signaling cascade activation, while calcium flux assays using fluorescent indicators like Fluo-4 can detect MC1R-mediated signaling when the receptor is artificially coupled to Gαq through chimeric G proteins or promiscuous G protein coupling. Multiplexed assays combining several readouts (e.g., cAMP accumulation, ERK phosphorylation, and β-arrestin recruitment) within the same cellular experiment reveal potential biased signaling properties of different ligands. For more physiologically relevant contexts, melanocyte cell lines transfected with Saguinus geoffroyi MC1R can be assessed for functional responses like melanin production or dendrite formation, connecting molecular signaling events to cellular phenotypes.

What are the critical differences in binding kinetics between recombinant MC1R from Saguinus geoffroyi and other closely related primate species?

Time-resolved fluorescence resonance energy transfer (TR-FRET) assays using lanthanide-labeled peptide ligands provide high sensitivity for detecting species-specific binding kinetics differences. Competition kinetic binding experiments with unlabeled ligands often reveal more pronounced species differences than equilibrium binding measurements, as kinetic parameters can vary even when equilibrium dissociation constants appear similar. The temperature dependence of binding kinetics, analyzed through van't Hoff plots, provides thermodynamic insights into species-specific binding mechanisms, potentially revealing differences in the entropy-enthalpy compensation patterns that indicate distinct binding modes or conformational changes upon ligand recognition.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.