Recombinant Saguinus imperator Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

MC1R Overview

The melanocortin 1 receptor (MC1R) is a G protein-coupled receptor (GPCR) critical for regulating melanogenesis, skin pigmentation, and UV-induced DNA repair . Activation by α-MSH stimulates cAMP signaling, promoting eumelanin synthesis and enhancing genomic stability . Loss-of-function MC1R variants are linked to fair skin, UV sensitivity, and melanoma risk in humans .

Research Findings in Tamarins

  • Platy-1 Retroposons: Saguinus genomes exhibit extensive Platy-1 retroposon amplification, which may influence genomic evolution but has no direct link to MC1R function .

  • MC1R Polymorphisms: While human MC1R variants are well-studied, tamarin MC1R research focuses on structural conservation. For example, S. midas MC1R shares 85% amino acid identity with human MC1R .

Applications and Implications

  • Melanoma Research: MC1R dysfunction correlates with UV sensitivity and impaired DNA repair (e.g., nucleotide excision repair) .

  • Pharmacological Targeting: MC1R agonists (e.g., synthetic melanocortins) are explored for melanoma prevention by enhancing pigmentation and DNA repair .

Comparative Analysis of MC1R in Primates

FeatureSaguinus midas MC1R Human MC1R
Amino Acid Length317317
Key Domains7 transmembrane helices7 transmembrane helices
Ligand Bindingα-MSH, cAMP-dependentα-MSH, cAMP-dependent
Associated PathwaysMelanogenesis, UV responseMelanogenesis, UV response

Unresolved Questions

  • Species-Specific Variants: Functional differences between S. imperator and S. midas MC1R remain uncharacterized.

  • Ligand Specificity: Structural determinants of α-MSH binding in tamarins require further study .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please clearly indicate your preference when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped standard with blue ice packs. If you require dry ice shipment, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag requirements, please communicate these to us, and we will prioritize development of the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Saguinus imperator (Emperor tamarin)
Target Names
Target Protein Sequence
MPMQGAQRKLLGSLNSTPTATSNLGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLETAVILLLEAGALATRTSAVQRLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIVTLPRTQRVIAAIWVASVLSSTLFI TYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAHGIIRLHKRQSPAHQGFGLRGA ATLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCSCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function
The Melanocyte-stimulating hormone receptor (MC1R) is a receptor for MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins which activate adenylate cyclase. It plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.