Recombinant Saguinus midas Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Saguinus midas (Midas tamarin) (Golden-handed tamarin)
Target Names
Target Protein Sequence
MPMHGAQRKLLGSLNSTPTATSNLGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLETAVILLLEAGALATRTSAMQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAIAAIWVASXLSSTLFI TYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAHGIIRLHKRQTPAHQGFGLRGA ATLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCSCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function
This receptor binds to Melanocyte-stimulating hormone (MSH) isoforms (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. It regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by controlling cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the MC1R protein and what is its functional role in Saguinus midas?

    The melanocortin-1 receptor (MC1R) in Saguinus midas (golden-handed tamarin) is a G protein-coupled receptor primarily located on the surface of melanocytes. Similar to humans, this receptor plays a crucial role in normal pigmentation by controlling which type of melanin is produced . When activated, MC1R triggers a series of chemical reactions inside melanocytes that stimulate these cells to produce eumelanin (dark pigment) rather than pheomelanin (red/yellow pigment) . The full-length Saguinus midas MC1R protein consists of 317 amino acids . In tamarins, MC1R likely contributes to their distinctive coat coloration patterns, though species-specific studies on its exact role in Saguinus midas pigmentation are still emerging.

  • What expression systems are utilized for producing recombinant Saguinus midas MC1R?

    Several expression systems are employed for producing recombinant Saguinus midas MC1R, each with advantages for different research applications:

    Expression SystemPropertiesApplicationsProduct Identifier
    E. coliHigh yield, potential inclusion bodies, lacks post-translational modificationsStructural studies, antibody productionCSB-EP774709SAS1 , RFL36130SF
    YeastSome eukaryotic post-translational modifications, high yieldFunctional studiesCSB-YP774709SAS1
    BaculovirusMore complex eukaryotic post-translational modificationsSignaling studiesCSB-BP774709SAS1
    Mammalian cellsMost physiologically relevant modificationsReceptor-ligand interactions, drug screeningCSB-MP774709SAS1

    For studies requiring proper folding and post-translational modifications of MC1R, mammalian or insect cell expression systems are preferred, while bacterial systems may be sufficient for applications such as antibody generation or structural analyses that don't require full functionality .

  • What are the optimal storage and handling conditions for recombinant Saguinus midas MC1R protein?

    Proper storage and handling of recombinant Saguinus midas MC1R is critical for maintaining protein stability and functionality:

    • Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple use

    • Avoid repeated freeze-thaw cycles which can significantly reduce protein activity

    • For short-term storage (up to one week), working aliquots can be kept at 4°C

    • The lyophilized powder form is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • For reconstitution, centrifuge the vial briefly before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

    • The default recommended final concentration of glycerol is 50%

    These conditions help preserve the native conformation and activity of the protein for experimental use.

Advanced Research Questions

  • How do variations in Saguinus midas MC1R compare to human MC1R polymorphisms associated with pigmentation phenotypes?

    While extensive research has characterized human MC1R polymorphisms and their association with red hair and fair skin, comparative data for Saguinus midas is more limited. In humans, specific MC1R variants (particularly rs1805007, rs1805008, and rs1805009) are strongly associated with red hair phenotypes, while others (rs1805005, rs2228479, and rs885479) show weaker effects .

    Research approaches to investigate Saguinus midas MC1R variations include:

    1. Sequencing MC1R genes from multiple Saguinus midas individuals to identify polymorphisms

    2. Functional characterization of variant receptors in vitro to assess signaling capabilities

    3. Correlating variant genotypes with coat color phenotypes across Saguinus midas populations

    4. Comparing conservation of functional domains between human and tamarin MC1R

    Understanding MC1R variations in Saguinus midas could provide insights into the evolution of pigmentation systems across primates and potentially identify novel functional variants not present in human populations .

  • What methodological approaches are recommended for studying MC1R signaling pathways in Saguinus midas?

    To investigate MC1R signaling pathways in Saguinus midas, researchers can employ several complementary approaches:

    1. cAMP Assays: Since MC1R activation primarily signals through adenylyl cyclase to increase cAMP production, measuring cAMP levels using ELISA or FRET-based assays after receptor stimulation with α-MSH or other agonists provides direct evidence of signaling activity.

    2. Calcium Mobilization: Using fluorescent calcium indicators to measure intracellular calcium flux following receptor activation.

    3. Receptor Binding Assays: Using radiolabeled or fluorescently labeled ligands to assess binding affinity of natural or synthetic ligands to the receptor.

    4. Western Blotting: To detect phosphorylation of downstream proteins in the signaling cascade, including CREB and MITF.

    5. Gene Expression Analysis: Measuring transcriptional changes in melanogenesis-related genes following receptor activation.

    6. Eumelanin/Pheomelanin Ratio Measurement: Quantifying the production of different melanin types in response to receptor activation using HPLC or spectrophotometric methods.

    These methods can reveal whether Saguinus midas MC1R signaling differs from that of humans or other primates, potentially identifying species-specific adaptations in the melanocortin system .

  • What are the implications of Saguinus midas MC1R research for comparative primate biology and evolution?

    Research on Saguinus midas MC1R contributes significantly to understanding primate evolution and adaptation:

    1. Phylogenetic Insights: Molecular analysis of MC1R can complement other genetic markers for resolving phylogenetic relationships within the Saguinus genus. Previous studies using ND1 mitochondrial sequences have shown that S. midas and S. bicolor are closely related sister groups , and MC1R sequence data could further refine these relationships.

    2. Adaptive Evolution: Comparing MC1R sequences across callitrichids can reveal signatures of selection, potentially linked to adaptation to different light environments or predation pressures.

    3. Convergent Evolution: Identifying whether similar MC1R variants have evolved independently in different primate lineages with similar coat colorations.

    4. Subspecies Differentiation: MC1R variation may help clarify taxonomic uncertainties within Saguinus midas, where previous research has suggested there may be three subspecies with two sharing the same morphotype .

    5. Conservation Implications: Molecular data from MC1R and other genes have suggested that "there is at least one Saguinus subspecies that has not yet been described and that the conservation status of Saguinus species and subspecies should be carefully revised using modern molecular approaches" .

    This research provides broader insights into pigmentation evolution across primates and potentially informs conservation efforts for golden-handed tamarins.

  • How does the chromosomal organization of MC1R in Saguinus midas compare with other Saguinus species?

    The chromosomal organization of genes in Saguinus midas shows important differences when compared to other Saguinus species:

    1. Both Saguinus midas and Saguinus bicolor present 2n = 46 chromosomes, but in S. midas, chromosome Y is the smallest .

    2. Studies using G-banding and distribution of retroelement LINE 1 have identified differences in chromosome pairs three and four that can be regarded as markers differentiating these species .

    3. The distribution pattern of LINE 1 for sexual chromosome X differs between S. bicolor individuals from different urban fragments, likely due to geographical isolation .

    4. While research has shown extensive independent amplification of Platy-1 retroposons in tamarins, with 8,187 elements unique to the S. midas genome , specific information about MC1R locus organization would require targeted studies.

    For researchers interested in MC1R genomic organization in Saguinus midas, fluorescence in situ hybridization (FISH) techniques similar to those used to study other genomic elements in these species would be appropriate. These approaches could reveal whether structural variations in the MC1R genomic region exist between closely related Saguinus species and potentially contribute to phenotypic differences .

  • What techniques can be used to investigate MC1R protein-protein interactions in Saguinus midas melanogenesis?

    To investigate protein-protein interactions involving Saguinus midas MC1R, researchers can employ several complementary techniques:

    1. Co-immunoprecipitation (Co-IP): Using antibodies against MC1R or its potential interaction partners to pull down protein complexes from Saguinus midas melanocytes or cells expressing recombinant proteins.

    2. Proximity Ligation Assay (PLA): This technique can visualize and quantify protein interactions in fixed cells with single-molecule resolution.

    3. Bioluminescence Resonance Energy Transfer (BRET): By tagging MC1R and potential interaction partners with appropriate donor/acceptor pairs, researchers can detect interactions in living cells.

    4. Surface Plasmon Resonance (SPR): Using purified recombinant proteins to measure binding kinetics and affinity constants.

    5. Yeast Two-Hybrid Screening: To identify novel interaction partners of MC1R in an unbiased manner.

    6. Cross-linking Mass Spectrometry: To identify interaction interfaces at amino acid resolution.

    These approaches can reveal whether Saguinus midas MC1R interacts with species-specific partners or whether conserved interactions exist across primate species. Particular attention should be paid to interactions with PTEN, given research showing MC1R is a potent regulator of PTEN after UV exposure in melanocytes , a pathway potentially relevant to understanding UV adaptation in different primate species.

  • What potential exists for using Saguinus midas MC1R research in pain perception studies?

    Research has established a connection between MC1R function and pain perception in humans and mice, with potential implications for comparative studies using Saguinus midas:

    1. Pain Threshold Assessment: Studies in mice carrying MC1R variants have shown higher pain thresholds . Similar studies could investigate whether Saguinus midas with different MC1R variants show varied responses to painful stimuli.

    2. Mechanistic Pathways: Research revealed that red-haired mice with MC1R variants have higher pain thresholds even without pigment synthesis, suggesting non-pigmentation roles of MC1R . Similar mechanistic studies in Saguinus midas could help determine if these pathways are conserved across primates.

    3. Opioid Sensitivity: Humans with certain MC1R variants respond more effectively to opioid pain medications, requiring lower doses . Comparative studies could investigate whether similar pharmacogenetic effects exist in non-human primates.

    4. Experimental Approach: Researchers could:

      • Sequence MC1R genes from Saguinus midas individuals

      • Correlate variants with pain threshold measurements using standardized pain assessment protocols

      • Investigate cellular mechanisms using primary cell cultures or recombinant expression systems

      • Study response to analgesics in relation to MC1R genotype

    This research direction offers potential insights into the evolution of pain perception mechanisms across primates and might identify conserved or divergent pathways with relevance to pain management in both humans and non-human primates .

  • How can researchers validate the functionality of recombinant Saguinus midas MC1R protein?

    Validating the functionality of recombinant Saguinus midas MC1R requires multiple complementary approaches:

    1. Ligand Binding Assays: Using radiolabeled or fluorescently labeled α-MSH or other MC1R ligands to confirm that the recombinant protein can bind its natural ligands with appropriate affinity.

    2. cAMP Production Assay: Since MC1R signals primarily through adenylyl cyclase activation, measuring cAMP production following stimulation with α-MSH confirms signaling capability.

    3. Calcium Mobilization: Secondary messenger responses can be measured using calcium-sensitive fluorescent dyes.

    4. Receptor Internalization: Fluorescently tagged receptors can be tracked for internalization following ligand binding, a process typical of functioning GPCRs.

    5. Downstream Pathway Activation: Measuring phosphorylation of downstream targets like CREB using western blotting.

    6. Comparative Functional Analysis: Side-by-side comparison with human MC1R to identify species-specific differences in activation, signaling, or regulation.

    7. Reconstitution in MC1R-deficient Cells: Expressing the recombinant protein in melanocytes lacking endogenous MC1R to rescue melanogenesis.

    These validation steps ensure that recombinant Saguinus midas MC1R proteins retain their native functional properties and are suitable for downstream experimental applications .

  • What are the challenges and solutions in working with membrane-bound G protein-coupled receptors like Saguinus midas MC1R?

    Researchers face several challenges when working with Saguinus midas MC1R as a membrane-bound GPCR:

    ChallengeExplanationSolution
    Protein solubilityGPCRs are inherently hydrophobic and difficult to solubilizeUse specialized detergents (DDM, LMNG) or lipid nanodiscs for solubilization
    Maintaining native conformationDetergents can disrupt protein structureOptimize detergent concentration; use stabilizing agents like cholesterol
    Low expression levelsGPCRs often express poorly in heterologous systemsUse codon-optimized sequences; employ specialized expression systems with chaperones
    Post-translational modificationsImportant for function but variable across expression systemsChoose appropriate expression system (mammalian for full modifications)
    Functional assaysMembrane context affects functionReconstitute in proteoliposomes or use whole-cell assays rather than purified protein
    Species-specific interactionsPartner proteins may differ between speciesCo-express with cognate G proteins or other partners from same species
    Stability during purificationGPCRs can rapidly lose activityWork at 4°C; add stabilizing ligands during purification

    Successful strategies include using fusion proteins (such as His-tags) for purification , employing stabilizing mutations, and working with nanobodies or antibody fragments that recognize and stabilize specific conformations. Specialized cryo-EM and crystallography techniques have advanced structural studies of GPCRs and could be applied to Saguinus midas MC1R .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.