Recombinant Saguinus oedipus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your tag type preference for prioritized development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Saguinus oedipus (Cotton-top tamarin)
Target Names
Target Protein Sequence
MPMQGAQRKLLGSLNSTPTATSNLGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAVAKNRNLHSSMYCFICCLALSDLLVSGSNMLETAVILLLETGALATRTSVVQQLHNTI NVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAIAAIWVASVLSSTLFI TYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAHGIIRLHKRQTPAHQGFGLRGA ATLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCSCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function

The Melanocyte-stimulating hormone receptor (MC1R) is a G protein-coupled receptor for α-, β-, and γ-MSH and ACTH. Its activation stimulates adenylate cyclase, mediating melanogenesis—the production of eumelanin (black/brown) and phaeomelanin (red/yellow) pigments—through cAMP signaling regulation in melanocytes.

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Saguinus oedipus MC1R and how does it compare to human MC1R?

The Melanocortin 1 Receptor (MC1R) in Saguinus oedipus, like other species, features seven transmembrane helices with an intracellular C-terminus containing an amphipathic helix 8 (fourth intracellular loop) . The receptor contains multiple conserved basic residues that are crucial for signaling function. Comparative analysis with human MC1R reveals significant homology, though species-specific variations occur particularly in the C-terminal region which influence receptor trafficking and downstream signaling capacity.

Methodologically, researchers can assess structural differences through:

  • Sequence alignment analysis

  • Hydropathy profiling

  • 3D structural modeling using homology-based approaches

  • Site-directed mutagenesis of key residues followed by functional assays

How is functional activity of recombinant Saguinus oedipus MC1R typically measured in laboratory settings?

Functional activity of recombinant Saguinus oedipus MC1R is primarily assessed through cAMP accumulation assays. This methodology involves:

  • Transient transfection of expression constructs into mammalian cells (commonly COS-7 cells)

  • Treatment with agonists such as α-MSH

  • Measurement of intracellular cAMP production

  • Comparison with wild-type receptors and variant constructs

A typical experimental setup would include control cells transfected with a plasmid encoding a marker like green fluorescent protein (GFP) . Results are generally presented as mean ± SEM from multiple independent assays performed in duplicate to ensure statistical validity.

What are the recommended expression systems for producing recombinant Saguinus oedipus MC1R?

For optimal expression of functional Saguinus oedipus MC1R, researchers should consider:

  • Mammalian expression systems: COS-7 cells are widely used for transient expression, as they provide appropriate post-translational modifications and cellular machinery for correct receptor folding and trafficking .

  • Inducible expression systems: Doxycycline-inducible systems allow for controlled expression levels, which is particularly valuable when studying receptors that may affect cell proliferation .

  • Viral transduction approaches: Lentiviral or retroviral delivery systems enable stable integration of the MC1R gene for long-term studies.

Expression should be verified through western blotting, immunofluorescence visualization, and functional assays to confirm proper receptor localization and activity.

How should researchers design cell-based assays to evaluate MC1R signaling in Saguinus oedipus compared to human systems?

When comparing MC1R signaling between Saguinus oedipus and human systems, researchers should implement a systematic experimental approach:

  • Parallel expression constructs: Create matched expression vectors with species-specific MC1R cDNAs under identical promoters.

  • Cell line selection: Use the same host cell line (typically HEK293 or COS-7) for both receptors to eliminate cell-type variables.

  • Signaling pathway analysis: Measure multiple downstream effectors:

    • cAMP accumulation using ELISA or FRET-based sensors

    • ERK/MAPK activation through phospho-specific antibodies

    • Calcium mobilization through fluorescent indicators

  • Dose-response characterization: Generate complete dose-response curves with α-MSH and other ligands (10^-12 to 10^-6 M concentration range).

  • Competition binding assays: Determine binding affinities using radiolabeled ligands.

This comprehensive approach allows for direct species comparison while controlling for experimental variables.

What protocols exist for studying the impact of MC1R activation on cell cycle progression in melanocytes?

Based on findings with human melanoma cells, researchers can adapt the following protocol for studying MC1R's impact on cell cycle progression in Saguinus oedipus cells:

Protocol outline:

  • Establish stable expression of GFP-tagged MC1R in melanocyte lineage cells using doxycycline-inducible systems .

  • Synchronize cells in G1 phase using thymidine double block protocol .

  • Release cells from synchronization in the presence or absence of:

    • Doxycycline (to induce receptor expression)

    • α-MSH (to activate the receptor)

  • Collect cells at multiple time points (0, 4, 8, 12, and 24 hours)

  • Analyze DNA content by flow cytometry using propidium iodide staining

  • Assess cell cycle distribution with particular attention to G2/M phase accumulation

  • Complementary approaches include:

    • BrdU incorporation assays

    • Immunoblotting for cyclin proteins

    • Analysis of cdc25B activity

Expected results: Active MC1R signaling may cause a delay in progression through mitosis, typically manifested as a 5-20% increase in cells with 4N DNA content at specific time points after synchronization release .

How can researchers effectively compare wild-type and variant forms of recombinant Saguinus oedipus MC1R?

To systematically compare wild-type and variant forms of recombinant Saguinus oedipus MC1R, researchers should implement this multiparameter approach:

  • Construct preparation:

    • Generate site-directed mutagenesis constructs in identical expression vectors

    • Include epitope tags (HA, FLAG, or GFP) for detection if appropriate

    • Verify all constructs by sequencing

  • Expression analysis:

    • Transfect paired constructs with equal DNA amounts

    • Quantify surface expression by cell-surface ELISA or flow cytometry

    • Assess total expression by western blotting

    • Visualize cellular localization by confocal microscopy

  • Functional characterization:

    ParameterMethodologyExpected Measurement
    Basal activitycAMP assay without agonistpmol cAMP/mg protein
    Maximal responsecAMP assay with saturating agonist% of wild-type response
    Potency (EC50)Dose-response curvenM concentration
    Ligand bindingCompetition bindingKi (nM)
    Signaling kineticsTime-course activationt1/2 (minutes)
  • Downstream effects:

    • Cell proliferation assays

    • Gene expression analysis (particularly pigmentation genes)

    • Cell cycle analysis as described previously

This approach enables quantitative assessment of how specific variations affect receptor function, similar to studies of the R307G variant in other primates .

What are the experimental approaches for studying MC1R-mediated protection against DNA damage in Saguinus oedipus melanocytes?

MC1R activation has been linked to protection against DNA damage through both pigmentary and non-pigmentary mechanisms . Researchers investigating this effect in Saguinus oedipus systems should employ:

Experimental design:

  • Cell model preparation:

    • Establish primary melanocyte cultures from Saguinus oedipus skin samples

    • Create paired cell lines with wild-type MC1R and silenced/inhibited MC1R

  • DNA damage induction protocols:

    • UV irradiation (UVA and UVB at physiologically relevant doses)

    • Chemical mutagens (H₂O₂, 4-nitroquinoline 1-oxide)

    • Oxidative stress inducers

  • Pre-treatment conditions:

    • α-MSH (10⁻⁸ M, 24h pre-treatment)

    • Forskolin (10μM, adenylyl cyclase activator)

    • Specific MC1R antagonists as negative controls

  • Assessment of DNA damage and repair:

    • Comet assay for direct DNA strand break quantification

    • Immunofluorescence for γH2AX foci

    • ELISA-based detection of cyclobutane pyrimidine dimers

    • PCR-based methods to quantify oxidative DNA damage products

  • Mechanistic investigations:

    • Analysis of nucleotide excision repair protein recruitment

    • Quantification of antioxidant enzyme expression and activity

    • Assessment of melanin production (as this may contribute to photoprotection)

This comprehensive approach will help determine whether MC1R in Saguinus oedipus provides similar DNA-protective effects as observed in human systems, and through what mechanisms these effects occur.

How can researchers investigate the cross-talk between MC1R signaling and MAPK pathways in Saguinus oedipus cells?

Based on findings that cAMP signaling downstream of MC1R can modulate MAPK activity , researchers should employ these approaches to study pathway cross-talk in Saguinus oedipus systems:

  • Experimental cell systems:

    • Transfected cell lines expressing recombinant Saguinus oedipus MC1R

    • Primary melanocytes isolated from Saguinus oedipus skin samples

    • Melanoma cell lines (if available from this species)

  • Pathway activation protocol:

    • Activate MC1R with α-MSH (10⁻⁹ to 10⁻⁷ M)

    • Stimulate MAPK pathway with growth factors (EGF, FGF)

    • Use pathway-specific inhibitors:

      • H-89 for PKA inhibition

      • U0126 for MEK/ERK inhibition

      • Specific Raf inhibitors

  • Signaling analysis techniques:

    • Western blotting for phosphorylated ERK1/2, MEK, and Raf

    • Immunoprecipitation to detect physical interactions between signaling components

    • Phosphoproteomic analysis using mass spectrometry

    • Real-time signaling using FRET-based reporters

  • Data collection timeframe:

    • Acute signaling (5-60 minutes post-stimulation)

    • Sustained effects (6-48 hours)

  • Functional readouts:

    • Cell proliferation/cell cycle progression

    • Melanin synthesis

    • Gene expression changes

This experimental framework will help establish whether the inhibitory effect of cAMP on MAPK signaling observed in human systems is conserved in Saguinus oedipus, providing evolutionary insights into MC1R function.

What approaches can be used to study the evolutionary differences in MC1R function between Saguinus oedipus and other primates?

To investigate evolutionary differences in MC1R function across primate species including Saguinus oedipus:

  • Comparative sequence analysis:

    • Phylogenetic tree construction based on MC1R sequences

    • Identification of positively selected residues using Ka/Ks ratio analysis

    • Structural mapping of variable regions onto 3D receptor models

  • Experimental validation of key residues:

    • Site-directed mutagenesis to introduce species-specific variations

    • Analysis of variants using cAMP accumulation assays and other functional readouts

    • Assessment of receptor trafficking and surface expression differences

  • Physiological context studies:

    • Correlate functional differences with species pigmentation phenotypes

    • Investigate UV resistance mechanisms across primate species

    • Examine DNA damage response in different primate melanocytes

This multi-faceted approach provides insights into how MC1R function has evolved across primates and how specific molecular adaptations relate to physiological traits.

What are the common challenges in expressing functional recombinant Saguinus oedipus MC1R and how can they be overcome?

Researchers often encounter several challenges when expressing functional recombinant Saguinus oedipus MC1R:

  • Low surface expression issues:

    • Challenge: G protein-coupled receptors (GPCRs) like MC1R can be retained intracellularly.

    • Solution: Optimize codon usage for mammalian expression; include signal sequences; use specialized expression vectors with chaperon proteins; test multiple cell lines for optimal expression.

  • Constitutive activity assessment:

    • Challenge: Distinguishing basal receptor activity from background cellular activity.

    • Solution: Include appropriate negative controls (untransfected cells, inactive receptor mutants); use inverse agonists to determine constitutive activity levels.

  • Protein degradation during purification:

    • Challenge: MC1R can be unstable during solubilization and purification attempts.

    • Solution: Use mild detergents (DDM, LMNG); include protease inhibitor cocktails; perform procedures at 4°C; consider adding stabilizing ligands during purification.

  • Functional assay sensitivity:

    • Challenge: Detecting small changes in cAMP production with variant receptors.

    • Solution: Employ high-sensitivity detection methods like BRET/FRET-based sensors or newer generation ELISA kits with improved sensitivity.

  • Species-specific post-translational modifications:

    • Challenge: Ensuring proper receptor processing in heterologous systems.

    • Solution: Consider using tamarin-derived cell lines when possible; verify glycosylation patterns; assess phosphorylation states of expressed receptors.

These approaches have been successful in studies of MC1R variants in other species and can be adapted for Saguinus oedipus MC1R expression.

How can researchers troubleshoot signaling assays when working with recombinant Saguinus oedipus MC1R?

When troubleshooting signaling assays for recombinant Saguinus oedipus MC1R, follow this systematic approach:

  • Verification of receptor expression:

    • Confirm expression by western blot and flow cytometry before proceeding

    • Ensure detection antibodies recognize the Saguinus oedipus MC1R sequence or use epitope tags

    • Quantify relative expression levels across experimental conditions

  • Assay optimization matrix:

    ParameterTest RangeOptimal Conditions
    Cell density2×10⁴ - 2×10⁵ cells/well[Determined empirically]
    Transfection reagentLipofectamine, calcium phosphate, PEI[Most effective method]
    DNA amount50-500 ng/well[Optimal amount]
    Stimulation time5-60 minutes[Optimal time]
    Assay buffer compositionVarying Ca²⁺, Mg²⁺ concentrations[Optimal composition]
  • Signal-to-background optimization:

    • Include phosphodiesterase inhibitors (IBMX) to prevent cAMP degradation

    • Optimize cell lysis conditions for maximum signal recovery

    • Consider serum starvation to reduce background signaling

    • Use positive controls (forskolin) to verify assay functionality

  • Receptor coupling verification:

    • Test functional coupling to G proteins using GTPγS binding assays

    • Use pertussis toxin to rule out Gi coupling

    • Consider coupling efficiency to different G protein subtypes

  • Troubleshooting decision tree:

    • If no signal: Check expression → verify ligand activity → assess G protein coupling

    • If high background: Optimize cell density → reduce serum → use selective inhibitors

    • If poor reproducibility: Standardize cell passage number → control transfection efficiency → ensure consistent stimulation protocols

This methodical approach helps isolate variables affecting MC1R signaling assays and should be documented thoroughly in research protocols.

What considerations are important when designing experiments to study MC1R-mediated effects on cell proliferation and cycle progression?

When studying MC1R effects on cell proliferation and cycle progression in Saguinus oedipus systems, researchers should consider these critical experimental design factors:

  • Cell model selection:

    • Use relevant cell types (melanocytes, melanoma cells) rather than generic expression systems when studying proliferation effects

    • Consider primary cells vs. immortalized lines (proliferation mechanisms may differ)

    • Establish inducible expression systems to control timing and level of MC1R expression

  • Synchronization considerations:

    • Thymidine double block provides effective G1/S synchronization

    • Validate synchronization efficiency before MC1R activation experiments

    • Allow sufficient time for recovery from synchronization stress

  • Activation protocol design:

    • Use appropriate ligand concentrations (typically 10⁻⁹ to 10⁻⁷ M α-MSH)

    • Include direct cAMP pathway activators (forskolin) as controls

    • Consider timing of activation relative to cell cycle phases

  • Comprehensive assessment metrics:

    • DNA content analysis for cell cycle distribution

    • BrdU incorporation for S-phase entry

    • Analysis of cell number over time using automated counting

    • Complementary proliferation assays (MTT, crystal violet)

    • Assessment of key cell cycle regulators (cyclins, CDKs, cdc25B)

  • Controls and variables:

    • Include MC1R-negative cells in all experiments

    • Control for potential effects of expression tags (GFP can affect proliferation)

    • Account for density-dependent effects on proliferation

    • Monitor for potential selection effects during long-term culture

  • Data analysis approaches:

    • Distinguish between cell cycle delay vs. arrest phenotypes

    • Calculate doubling times rather than single timepoint measurements

    • Consider population heterogeneity in asynchronous cultures

    • Perform statistical analysis appropriate for time-course experiments

These considerations will enable robust examination of MC1R's effects on cell proliferation, similar to findings in melanoma cells where MC1R activation delayed cell cycle progression .

How might researchers investigate the potential relationship between Saguinus oedipus MC1R function and susceptibility to melanoma or other skin cancers?

To investigate potential relationships between Saguinus oedipus MC1R function and skin cancer susceptibility, researchers should consider these innovative approaches:

  • Genetic screening approaches:

    • Sequence MC1R genes from multiple Saguinus oedipus individuals

    • Identify natural polymorphisms in the tamarin population

    • Correlate variants with pigmentation phenotypes and UV sensitivity

  • Functional characterization of tamarin MC1R variants:

    • Express identified variants in cellular systems

    • Assess signaling capacity using cAMP accumulation assays

    • Evaluate DNA damage responses after UV exposure

    • Analyze cell cycle effects of variant receptors

  • Comparative susceptibility models:

    • Develop tamarin melanocyte culture models from different MC1R genotypes

    • Expose to UV radiation and analyze transformation markers

    • Compare mutation signatures and DNA damage repair capacity

    • Assess phaeomelanin production, as this pigment may contribute to oxidative damage

  • Molecular epidemiology approaches:

    • If pathology data exists for this species, correlate MC1R variants with skin lesion prevalence

    • Compare with human data on MC1R variant associations with melanoma risk

    • Consider environmental UV exposure differences between natural habitats

  • Experimental skin models:

    • Develop 3D organotypic skin cultures from tamarin cells

    • Create CRISPR-edited melanocyte lines with specific MC1R variants

    • Test responses to carcinogens and UV radiation

This research direction could provide evolutionary insights into the relationship between MC1R function and cancer susceptibility across primate species, and might identify novel protective mechanisms present in tamarin MC1R signaling.

What experimental designs would be appropriate for investigating the non-pigmentary effects of MC1R signaling in Saguinus oedipus?

To investigate non-pigmentary effects of MC1R signaling in Saguinus oedipus, researchers should consider these experimental approaches:

  • DNA damage response evaluation:

    • Treat MC1R-expressing tamarin cells with α-MSH before UV exposure

    • Assess DNA repair efficiency through comet assays and repair protein recruitment

    • Compare nucleotide excision repair rates between MC1R-active and MC1R-deficient cells

    • Evaluate the protective effect against oxidative damage independent of melanin production

  • Inflammatory response modulation:

    • Challenge tamarin immune cells with inflammatory stimuli ± MC1R activation

    • Measure inflammatory cytokine production through multiplex assays

    • Assess NF-κB signaling pathway activity

    • Create co-culture systems with melanocytes and immune cells

  • Cell survival pathway investigation:

    • Apply apoptotic stimuli to tamarin cells with varying MC1R activity levels

    • Evaluate anti-apoptotic protein expression after MC1R activation

    • Assess survival signaling pathways (PI3K/Akt) downstream of MC1R

    • Compare with human systems to identify species-specific survival mechanisms

  • Proliferation and cell cycle regulation:

    • Analyze effects on cdc25B activity and other cell cycle regulators

    • Investigate potential tumor-suppressive functions through colony formation assays

    • Assess MAPK pathway modulation by MC1R signaling

    • Evaluate effects on contact inhibition and anchorage-independent growth

  • Transcriptomic analysis:

    • Perform RNA-seq on tamarin cells ± MC1R activation

    • Filter out pigmentation-related genes

    • Identify novel pathway enrichment after MC1R signaling

    • Compare with human melanocyte transcriptional responses

These experimental approaches would help elucidate the full spectrum of MC1R functions beyond melanin production, providing insights into the receptor's role in cellular homeostasis, stress responses, and potential tumor-suppressive functions in Saguinus oedipus.

How can researchers investigate potential species-specific differences in MC1R pharmacology between Saguinus oedipus and humans?

To characterize species-specific differences in MC1R pharmacology between Saguinus oedipus and humans, researchers should implement:

  • Comprehensive pharmacological profiling:

    • Create stable cell lines expressing either human or Saguinus oedipus MC1R

    • Test a panel of melanocortin peptides (α-MSH, β-MSH, ACTH, synthetic analogues)

    • Generate complete dose-response curves for each ligand

    • Determine key parameters:

    ParameterMeasurement MethodComparative Analysis
    Binding affinity (Kd)Radioligand bindingSpecies difference ratio
    Potency (EC50)cAMP accumulationRank order comparison
    Efficacy (Emax)Maximum response% of reference agonist
    Binding kineticsAssociation/dissociation ratest1/2 comparison
    Biased signalingMultiple pathway assaysPathway preference profiles
  • Structure-activity relationship studies:

    • Test modified peptide analogues with single amino acid substitutions

    • Identify residues critical for species-specific responses

    • Create a pharmacophore model for each species receptor

  • Antagonist evaluation:

    • Screen known MC1R antagonists against both receptors

    • Test inverse agonist activity if receptors show constitutive activity

    • Assess competitive vs. non-competitive mechanisms

  • Allosteric modulator discovery:

    • Screen for compounds that modulate agonist responses

    • Characterize positive and negative allosteric modulators

    • Map species-specific allosteric sites

  • Molecular dynamics simulations:

    • Build 3D models of both receptors

    • Simulate ligand binding and receptor activation

    • Identify species-specific conformational changes

  • Chimeric receptor approach:

    • Create domain-swapped receptors between species

    • Identify regions responsible for pharmacological differences

    • Mutate key residues based on sequence alignment

This systematic pharmacological characterization would provide valuable insights into evolutionary adaptations of MC1R signaling and might identify novel ligand interaction patterns specific to Saguinus oedipus.

How can researchers integrate MC1R functional studies in Saguinus oedipus with broader evolutionary biology questions?

Integrating MC1R functional studies in Saguinus oedipus with evolutionary biology creates valuable interdisciplinary research opportunities:

  • Adaptive pigmentation evolution:

    • Correlate MC1R sequence variations with coat color patterns across tamarin populations

    • Analyze functional consequences of natural polymorphisms

    • Link receptor activity differences to ecological pressures (UV exposure, predation, etc.)

    • Compare with other New World monkey species to identify convergent/divergent evolution

  • Molecular clock and selection analyses:

    • Calculate selection pressures (dN/dS ratios) on different MC1R domains

    • Identify rapidly evolving vs. conserved regions across primates

    • Compare with selection patterns in other melanocortin receptors

    • Create dated phylogenetic trees based on MC1R sequence evolution

  • Ecological adaptation studies:

    • Correlate MC1R function with species habitat (forest canopy vs. ground-dwelling)

    • Assess UV exposure adaptations in different primate lineages

    • Compare tropical vs. temperate adapted primate MC1R function

    • Analyze behavioral adaptations that might complement MC1R-mediated protection

  • Experimental models for human evolution:

    • Study Saguinus oedipus MC1R as a model for understanding human MC1R variants

    • Compare with archaic hominin receptor functions (e.g., Neanderthal R307G variant)

    • Investigate parallel evolution of MC1R function across distantly related species

  • Genomic context integration:

    • Analyze co-evolution of MC1R with other pigmentation genes

    • Study gene regulatory networks controlling MC1R expression

    • Identify species-specific promoter elements and transcription factors

    • Compare with genome-wide selection patterns

This integrative approach links molecular function to evolutionary processes, providing insights into how natural selection has shaped MC1R function across primate lineages and revealing the molecular basis of adaptive traits.

What methodologies can be used to investigate the relationship between MC1R function and behavioral aspects in Saguinus oedipus?

Investigating the relationship between MC1R function and behavior in Saguinus oedipus requires integrating molecular and behavioral approaches:

  • Association studies in captive populations:

    • Genotype MC1R variants in captive tamarin colonies

    • Conduct standardized behavioral assessments (e.g., novel object tests, social interaction)

    • Analyze correlations between genetic variants and behavioral phenotypes

    • Control for relatedness and environmental factors

  • Neuroendocrine integration:

    • Investigate MC1R expression in tamarin brain tissues

    • Study potential neuromodulatory effects of melanocortins in the CNS

    • Assess behavioral changes following peripheral α-MSH administration

    • Examine stress response differences based on MC1R genotype

  • Social signaling hypotheses:

    • Analyze how MC1R-determined coat coloration affects social interactions

    • Conduct preference tests for mating choices based on coloration

    • Observe group dynamics in mixed-phenotype colonies

    • Study potential warning coloration effects against predators

  • Experimental approaches combining behavior and molecular biology:

    • Administer MC1R agonists/antagonists and monitor behavioral outcomes

    • Track daily activity patterns in relation to UV exposure and MC1R variants

    • Examine social learning abilities across different MC1R genotypes

    • Study potential links between MC1R variants and cognitive flexibility

  • Field-based observational studies:

    • Document behaviors in wild populations with different MC1R variants

    • Record habitat utilization patterns (canopy vs. understory preference)

    • Analyze foraging strategies and potential links to pigmentation crypsis

    • Observe predator avoidance behaviors in differently pigmented individuals

This multidisciplinary approach could reveal previously unknown connections between pigmentation genetics and behavioral adaptations in primates, potentially uncovering pleiotropic effects of MC1R beyond its canonical role in pigmentation.

How can computational approaches enhance our understanding of Saguinus oedipus MC1R function and evolution?

Computational approaches offer powerful tools for understanding Saguinus oedipus MC1R function and evolution:

  • Structural bioinformatics:

    • Generate homology models of tamarin MC1R using AlphaFold or RoseTTAFold

    • Perform molecular dynamics simulations of receptor-ligand interactions

    • Identify species-specific binding pockets and activation mechanisms

    • Compare with human MC1R structural models to identify functional differences

  • Molecular evolution analyses:

    • Apply Bayesian phylogenetic methods to trace MC1R evolution across primates

    • Calculate site-specific selection pressures using PAML or HyPhy

    • Identify episodic selection events in primate lineages

    • Model ancestral MC1R sequences at key evolutionary nodes

  • Systems biology integration:

    • Construct gene regulatory networks around MC1R in tamarins

    • Perform in silico pathway analysis of MC1R signaling

    • Model cell cycle effects based on experimental data

    • Simulate population-level effects of MC1R variants

  • Machine learning applications:

    • Develop predictive models for functional effects of MC1R variants

    • Train algorithms to identify novel regulatory elements controlling MC1R expression

    • Apply pattern recognition to correlate MC1R sequence features with functional outcomes

    • Use natural language processing to extract MC1R knowledge from scientific literature

  • Population genetics simulations:

    • Model selection pressures on MC1R in tamarin populations

    • Simulate genetic drift and bottleneck effects on MC1R diversity

    • Predict variant frequency changes under different environmental scenarios

    • Compare with actual genetic data from wild populations

These computational approaches complement experimental methods by generating testable hypotheses, providing evolutionary context, and enabling systems-level understanding of MC1R function that would be difficult to achieve through laboratory experiments alone.

What novel technologies might enhance research on recombinant Saguinus oedipus MC1R in the next decade?

Emerging technologies poised to transform research on recombinant Saguinus oedipus MC1R include:

  • Advanced structural biology techniques:

    • Cryo-EM for determining MC1R structure at near-atomic resolution

    • Single-particle analysis of MC1R in different activation states

    • Hydrogen-deuterium exchange mass spectrometry for dynamic conformational studies

    • Surface plasmon resonance for real-time ligand binding kinetics

  • Genome editing advancements:

    • Prime editing for precise modification of MC1R in primary tamarin cells

    • Base editing for creating specific point mutations without double-strand breaks

    • CRISPR activation/interference systems to modulate endogenous MC1R expression

    • Knock-in reporter systems to track MC1R expression in real-time

  • Single-cell technologies:

    • Single-cell RNA-seq to identify cell-specific responses to MC1R activation

    • Single-cell proteomics to map pathway activation at individual cell level

    • Spatial transcriptomics to analyze MC1R expression patterns in tissue context

    • Live-cell single-molecule imaging of MC1R signaling dynamics

  • Organoid and tissue engineering:

    • Tamarin skin organoids for studying MC1R in a tissue-like environment

    • Organ-on-chip systems incorporating multiple cell types

    • 3D bioprinting of skin equivalents with defined MC1R variants

    • Patient-derived xenografts for in vivo studies of MC1R function

  • AI and computational biology:

    • Deep learning prediction of MC1R-ligand interactions

    • Neural networks for analyzing complex MC1R signaling datasets

    • Automated literature mining for MC1R knowledge synthesis

    • In silico clinical trial simulations for MC1R-targeted therapeutics

These technological advances will enable more precise, comprehensive, and physiologically relevant studies of MC1R function, potentially revealing new aspects of receptor biology impossible to detect with current methods.

What are the key unanswered questions regarding Saguinus oedipus MC1R that future research should address?

Despite significant advances in MC1R research, several fundamental questions about Saguinus oedipus MC1R remain unanswered:

  • Evolutionary adaptation questions:

    • How has MC1R function in Saguinus oedipus adapted to specific environmental pressures?

    • What selective forces have shaped MC1R evolution in this species compared to other primates?

    • Are there tamarin-specific post-translational modifications or regulatory mechanisms?

    • How does MC1R diversity within tamarin populations correlate with habitat diversity?

  • Signaling mechanism questions:

    • Does Saguinus oedipus MC1R exhibit biased signaling properties not present in human MC1R?

    • What is the full spectrum of G protein coupling for tamarin MC1R?

    • How does MC1R signaling integrate with other pathways in tamarin melanocytes?

    • Are there species-specific differences in receptor desensitization and trafficking?

  • Functional impact questions:

    • Does MC1R in Saguinus oedipus protect against DNA damage through mechanisms similar to human MC1R?

    • What is the relationship between MC1R function and cell cycle regulation in tamarin cells?

    • How does MC1R signaling affect the MAPK pathway in this species?

    • Are there tamarin-specific MC1R variants that provide unique functional properties?

  • Translational research questions:

    • Could comparative studies of human and tamarin MC1R reveal new therapeutic targets?

    • Are there protective mechanisms in tamarin MC1R that could inform human melanoma prevention?

    • How do environmental factors interact with MC1R genotype in determining cancer susceptibility?

    • Could tamarin-specific MC1R ligands offer novel pharmacological properties?

  • Methodological challenges:

    • What are optimal expression systems for functional studies of tamarin MC1R?

    • How can we develop tamarin-specific antibodies and detection reagents?

    • What are appropriate cell models for studying MC1R function in this species?

    • How can we ethically source and utilize tamarin biological materials for research?

Addressing these questions will require interdisciplinary approaches and may yield insights relevant not only to evolutionary biology but also to human health, particularly regarding melanoma susceptibility and protection.

How might research on Saguinus oedipus MC1R contribute to broader understanding of melanoma risk and prevention?

Research on Saguinus oedipus MC1R offers unique opportunities to advance melanoma research through comparative biology approaches:

  • Evolutionary insights into protective mechanisms:

    • Identify potentially protective MC1R variants unique to Saguinus oedipus

    • Compare DNA repair capabilities between species with different MC1R signaling properties

    • Analyze species differences in melanoma susceptibility in relation to MC1R function

    • Discover novel protective pathways that evolved differently across primates

  • Comparative oncology applications:

    • Determine whether tamarins develop UV-induced or spontaneous melanocytic lesions

    • Compare melanoma progression pathways between humans and tamarins

    • Identify species-specific tumor suppressor mechanisms linked to MC1R

    • Study whether MC1R-mediated cell cycle regulation differs between species

  • Novel pharmacological targets:

    • Screen for tamarin-specific MC1R ligands with unique signaling properties

    • Identify species-specific allosteric modulators of MC1R function

    • Explore differences in downstream effector coupling that might be therapeutically relevant

    • Develop peptide analogues based on evolutionary analysis of melanocortin peptides

  • Risk prediction models:

    • Compare how MC1R variants affect melanoma risk across species

    • Develop improved algorithms for predicting variant effects on receptor function

    • Identify gene-environment interactions that modify MC1R-associated risk

    • Create more nuanced models of how pigmentation phenotypes relate to cancer risk

  • Preventive strategies development:

    • Explore how tamarin MC1R may confer protection through non-pigmentary mechanisms

    • Investigate potential compounds that mimic protective MC1R signaling

    • Develop topical agents that activate DNA repair pathways downstream of MC1R

    • Study how MC1R signaling might be enhanced to provide protection against UV damage

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.