Recombinant Saguinus oedipus Membrane cofactor protein (CD46)

Shipped with Ice Packs
In Stock

Description

Complement Regulation

CD46 acts as a cofactor for factor I-mediated cleavage of C3b and C4b, preventing complement-mediated cell lysis. Key differences in Saguinus oedipus CD46 include:

  • Reduced Pathogen Binding: The absence of SCR1 and mutations in SCR2 (e.g., Arg103→Gln) impair interactions with pathogens like measles virus .

  • C3b/C4b Inactivation: Retains cofactor activity but with altered efficiency due to structural variations .

Pathogen Interactions

  • Measles Virus: SCR1 deletion in Saguinus CD46 abolishes binding to the measles virus hemagglutinin protein .

  • Adenovirus: The bent SCR3-SCR4 junction may influence adenovirus fiber knob interactions .

Recombinant Production

Recombinant Saguinus oedipus CD46 is produced using systems such as HEK293 or CHO cells to ensure proper glycosylation . Key parameters include:

ParameterDetail
Expression VectorpTM1 (vaccinia) or mammalian vectors
TagHis-tag or Fc-fusion
Molecular Weight~40–67 kDa (reduced SDS-PAGE)
Purity>90% (Coomassie-stained gels)

Research Applications

  • Immune Evasion Studies: Used to investigate how pathogens like Neisseria and herpesviruses exploit CD46 in New World monkeys .

  • Autoimmunity Models: SCR1-deficient CD46 helps study complement dysregulation in hemolytic uremic syndrome .

  • Structural Biology: Crystallography reveals bent SCR3-SCR4 conformations impacting ligand binding .

Binding Assays

Insect cells expressing measles virus hemagglutinin (Sf9-H) show no binding to Saguinus CD46 due to SCR1 deletion, unlike Old World monkey variants .

SpeciesSCR1 StatusMeasles Virus Binding
HumanIntactYes
Saguinus oedipusDeletedNo
BaboonIntactReduced (Arg103→Gln)

Unresolved Questions

  • Cytoplasmic Signaling: Role of CYT-1/CYT-2 isoforms in Saguinus T-cell regulation remains unexplored .

  • STP Region Variants: Impact of alternative splicing on pathogen evasion strategies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery estimates, please consult your local distributor.
Note: All our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can serve as a reference for your use.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CD46; MCP; Membrane cofactor protein; CD antigen CD46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-370
Protein Length
Full Length of Mature Protein
Species
Saguinus oedipus (Cotton-top tamarin)
Target Names
Target Protein Sequence
DACGPPPTFEAMELTSRPKPYYKVGERVEYDCKKGYHHFAPFLTHSICDRNHTWLPISDEPCVRKVCHYIPNPLHGEAILANGSYSFGNQLHFICNDGYYLIGKEILYCELKGSDAVWSGRPPICQKILCKPPPKINNGKHTFSDVDVFEYLDAVTYSCDPAPGPDPFSLIGESTIYCRDNSVWSGDAPECKVVKCRFPVIENGKQIAGFGKKFYYKATVIFECDEGFHIIGSDTIVCNSNSTWDPPVPKCVKVSTSPATVSPTSSVPGYPNPDEGMLNSLDEWAIALIVIAILVGVAIISFGLHRYLQRRKKKGKADGTAEYATYQSKSATLAEQRS
Uniprot No.

Target Background

Function
Membrane Cofactor Protein (CD46) serves as a cofactor for complement factor I, a serine protease. It safeguards autologous cells from complement-mediated injury by cleaving C3b and C4b deposited on host tissue. It may be involved in the fusion of sperm with the oocyte during fertilization. Additionally, it acts as a costimulatory factor for T-cells, inducing the differentiation of CD4+ into T-regulatory 1 cells. T-regulatory 1 cells suppress immune responses by secreting interleukin-10, suggesting a role in preventing autoimmunity.
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane; Single-pass type I membrane protein.

Q&A

What is Membrane Cofactor Protein (CD46) and why is it significant in research?

Membrane Cofactor Protein (CD46) is a type I transmembrane glycoprotein belonging to the Regulators of Complement Activation (RCA) family. It serves as a cofactor for serine protease factor I to cleave and inactivate C3b and C4b deposited on host cells, thereby protecting cells from complement-mediated damage. CD46's significance extends beyond complement regulation to roles in human reproduction, autophagy, T cell modulation, and as part of the intracellular complement system (complosome). Its importance in research stems from its diverse biological functions and association with numerous pathological conditions, including inflammatory disorders and cancer. Furthermore, CD46 acts as a receptor for multiple pathogens, earning it the nickname "pathogen magnet," making it a critical target for understanding host-pathogen interactions .

What are the functional domains of CD46 and their specific roles?

CD46 contains multiple functional domains, each serving distinct roles:

DomainLocationPrimary Functions
SCR1N-terminalPathogen binding (especially measles virus), complement regulation
SCR2Following SCR1Critical for measles virus binding, contains key glycosylation site
SCR3 & SCR4Central domainsBinding sites for some pathogens (HHV-6A, S. pyogenes), complement regulation
Serine/Threonine/Proline-rich regionFollowing SCRsHeavy O-glycosylation, provides structural support
Transmembrane domainCell membraneAnchors protein to cell surface
Cytoplasmic tail (CYT-1/CYT-2)C-terminalSignaling functions, regulates T cell responses, autophagy

Each domain contributes uniquely to CD46's multiple functions, with SCR1 and SCR2 being particularly critical for pathogen recognition and complement regulation. The cytoplasmic tails (resulting from alternative splicing) determine downstream signaling pathways and cellular responses. Mutations or alterations in specific domains can significantly impact CD46's functionality, leading to various pathological conditions .

What are the optimal expression systems for producing recombinant Saguinus oedipus CD46?

The choice of expression system for recombinant Saguinus oedipus CD46 depends on the research objectives, particularly regarding post-translational modifications and functional activity. Based on current methodologies:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, well-suited for structural studiesLacks glycosylation, may require refolding protocols
Insect cells (Sf9)Supports some post-translational modifications, good for binding studiesMore complex than bacterial systems, intermediate cost
Mammalian cellsMost physiological glycosylation pattern, ideal for functional studiesLower yield, higher cost, longer production time

What are the recommended protocols for reconstitution and storage of lyophilized recombinant CD46?

Proper reconstitution and storage are crucial for maintaining the functional integrity of recombinant Saguinus oedipus CD46. The recommended protocol includes:

Reconstitution Procedure:

  • Centrifuge the vial briefly before opening to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%)

  • Aliquot into single-use volumes to prevent freeze-thaw damage

Storage Conditions:

  • Short-term working aliquots: 4°C for up to one week

  • Long-term storage: -20°C/-80°C

  • Avoid repeated freeze-thaw cycles that can denature the protein

The reconstituted protein maintains optimal activity in Tris/PBS-based buffer with 6% Trehalose at pH 8.0. For experimental applications requiring different buffers, preliminary stability tests are recommended to ensure protein functionality. Proper reconstitution and storage significantly impact experimental reproducibility, particularly in functional assays where protein conformation is critical .

How can researchers verify the functional activity of recombinant Saguinus oedipus CD46?

Verifying the functional activity of recombinant Saguinus oedipus CD46 requires multiple complementary approaches:

Biochemical Verification:

  • SDS-PAGE analysis to confirm purity (>90%) and expected molecular weight

  • Western blotting with anti-CD46 or anti-His antibodies to confirm identity

  • Circular dichroism to assess proper protein folding

Functional Assays:

  • Complement Regulation Assay: Measure factor I cofactor activity by assessing C3b/C4b cleavage in the presence of recombinant CD46

  • Binding Assays: Test interactions with known ligands using:

    • ELISA-based binding assays with purified complement components

    • Flow cytometry to assess cell surface binding

    • Surface plasmon resonance to determine binding kinetics

  • Pathogen Interaction Studies:

    • Hemagglutination assays with measles virus

    • Binding assays using Sf9 insect cells expressing measles virus hemagglutinin protein

A quick and sensitive method to verify functionality is the binding assay with Sf9-H cells (expressing measles virus hemagglutinin), which can be quantified using Bluogal or ONPG substrates. This approach offers advantages over more complex methods like infection assays or fluorescence microscopy .

How can site-directed mutagenesis of Saguinus oedipus CD46 provide insights into pathogen binding mechanisms?

Site-directed mutagenesis of Saguinus oedipus CD46 represents a powerful approach for dissecting the molecular determinants of pathogen binding and complement regulation. This methodology enables:

  • Mapping of Critical Binding Residues:

    • Creating mutations that mimic natural variations found in other primate species (e.g., the Arg103Gln mutation observed in baboon CD46 that reduces measles virus binding)

    • Targeting glycosylation sites (particularly in SCR2) to assess their contribution to protein-protein interactions

    • Altering charged residues in SCR1 and SCR2 domains (such as GluArg at positions 58-59, which when mutated to AlaAla completely abolishes measles virus binding)

  • Structure-Function Relationship Analysis:

    • Systematic mutation of conserved versus variable regions to identify species-specific determinants of binding

    • Creation of chimeric constructs combining domains from different species to pinpoint interaction interfaces

    • Introduction of fluorescent tags at non-critical sites to monitor real-time binding dynamics

  • Therapeutic Target Development:

    • Identification of mutations that enhance or inhibit specific pathogen interactions while preserving complement regulatory functions

    • Design of decoy molecules based on critical binding epitopes

Past research has successfully used site-directed mutagenesis to identify that alterations in the SCR1 and SCR2 domains significantly impact measles virus binding. The approach revealed that particular amino acid residues (especially at positions 58-59 and 103) are crucial for these interactions. Researchers can apply similar methodologies to investigate Saguinus oedipus CD46 interactions with other pathogens, potentially revealing species-specific vulnerabilities or resistance mechanisms .

What comparative insights can be gained from studying Saguinus oedipus CD46 versus other primate CD46 variants?

Comparative analysis of Saguinus oedipus CD46 with other primate variants provides valuable evolutionary and functional insights:

Evolutionary Adaptation Patterns:

  • New World monkeys (including Saguinus oedipus) show deletions in the SCR1 domain not present in Old World primates or humans

  • These structural differences correlate with pathogen susceptibility profiles, particularly for measles virus

  • Natural variations serve as "evolutionary experiments" that highlight functional constraints and adaptive pressures

Species-Specific Pathogen Interactions:

  • Old World monkey erythrocytes (e.g., African green monkeys, rhesus macaques) hemagglutinate in the presence of measles virus

  • Baboon erythrocytes show reduced hemagglutination due to an Arg-to-Gln mutation at position 103 in SCR2

  • New World monkey erythrocytes fail to hemagglutinate due to SCR1 domain deletion

Functional Consequences of Structural Variations:

Primate GroupKey CD46 VariationsFunctional ImpactResearch Implications
HumanFour major isoforms (alternative splicing)Broad pathogen susceptibilityStandard for therapeutic development
Old World MonkeysVariations in SCR2 (e.g., position 103)Modified pathogen binding affinityModels for graduated response
New World MonkeysSCR1 domain deletionResistance to certain pathogensModels for natural immunity

These comparative studies help identify conserved regions essential for basic CD46 function versus variable regions that may confer species-specific advantages. Such knowledge informs the design of therapeutic interventions targeting CD46-mediated pathologies while minimizing disruption of essential functions .

How does glycosylation affect the structure and function of recombinant Saguinus oedipus CD46?

Glycosylation profoundly influences both structural integrity and functional properties of recombinant Saguinus oedipus CD46:

Types and Locations of Glycosylation:

  • N-linked glycosylation sites primarily in the SCR domains

  • O-linked glycosylation concentrated in the serine/threonine/proline-rich region

  • SCR2 contains a particularly critical N-glycosylation site that impacts pathogen binding

Functional Impact of Glycosylation:

  • Structural Stability: Glycans contribute to proper folding and resistance to proteolytic degradation

  • Pathogen Recognition: Experimental deletion of the SCR2 glycosylation site substantially reduces binding to measles virus hemagglutinin

  • Complement Regulation: Differential glycosylation patterns affect C3b/C4b binding and factor I cofactor activity

  • Immunogenicity: Glycosylation patterns influence recognition by the immune system

Expression System Considerations:
Different expression systems produce distinct glycosylation patterns that can significantly alter CD46 functionality:

  • E. coli-expressed CD46 lacks glycosylation entirely

  • Insect cell expression provides some glycosylation but with simpler structures than mammalian systems

  • Mammalian expression yields the most physiologically relevant glycosylation pattern

For studies focused on pathogen interactions or complement regulation, researchers should consider expression systems that maintain appropriate glycosylation. Alternatively, site-directed mutagenesis to create glycosylation-deficient variants can help determine which glycosylation sites are critical for specific functions. Studies have demonstrated that mutations affecting glycosylation in SCR2 significantly impair measles virus binding, highlighting the importance of these post-translational modifications .

How can Saguinus oedipus CD46 be utilized in studying cross-species pathogen transmission?

Recombinant Saguinus oedipus CD46 serves as a valuable tool for investigating cross-species pathogen transmission mechanisms:

Research Applications:

  • Zoonotic Potential Assessment:

    • Comparative binding assays between human and Saguinus oedipus CD46 with emerging pathogens

    • Identification of molecular adaptations required for successful cross-species transmission

    • Prediction of potential zoonotic threats based on receptor utilization patterns

  • Evolutionary "Arms Race" Studies:

    • Analysis of positive selection signatures in CD46 sequences across primates

    • Correlation of structural variations with pathogen exposure history

    • Reconstruction of ancestral CD46 sequences to track co-evolution with pathogens

  • Methodological Approaches:

    • Recombinant expression of both Saguinus oedipus and human CD46 under identical conditions

    • Side-by-side binding assays with various pathogens (viruses, bacteria)

    • Competitive inhibition studies to determine relative binding affinities

    • Creation of chimeric receptors to pinpoint species-barrier determinants

Understanding the molecular determinants that permit or restrict cross-species transmission has significant implications for predicting and potentially preventing future zoonotic events. The fact that CD46 serves as a receptor for multiple pathogens (including measles virus, herpesvirus 6, adenovirus, and bacterial pathogens) makes it particularly valuable for such studies. Research has already demonstrated that natural variations in primate CD46 correlate with susceptibility to various pathogens, providing a foundation for broader cross-species transmission studies .

What role does CD46 play in the intracellular complement system (complosome) and how can this be studied using the Saguinus oedipus model?

CD46 functions as a key component of the intracellular complement system (complosome), with important implications for cellular metabolism and immune responses:

Complosome Functions Involving CD46:

  • Modulation of CD4+ T cell activation and differentiation

  • Regulation of metabolic reprogramming during immune cell activation

  • Control of autophagy processes during pathogen invasion or oxidative stress

  • Provision of costimulatory signals during TCR engagement

  • Enhancement of CD8+ T cell effector functions

Experimental Approaches Using Saguinus oedipus CD46:

  • Comparative Signaling Studies:

    • Analysis of cytoplasmic tail variants (CYT-1 vs. CYT-2) and their downstream signaling pathways

    • Measurement of intracellular complement component activation following CD46 engagement

    • Comparison with human CD46 to identify conserved versus species-specific signaling mechanisms

  • Cellular Metabolism Investigation:

    • Assessment of metabolic changes (glycolysis, OXPHOS) following CD46 activation

    • Measurement of nutrient uptake rates in cells expressing Saguinus oedipus CD46

    • Correlation of metabolic profiles with immune effector functions

  • Technical Considerations:

    • Generation of cell lines expressing Saguinus oedipus CD46 with fluorescent tags on cytoplasmic domains

    • Development of phospho-specific antibodies to monitor activation states

    • Use of metabolic flux analysis to track CD46-dependent metabolic reprogramming

Research has demonstrated that CD46 signaling via its cytoplasmic tails significantly impacts cellular behavior, including macrophage activity and survival, autophagy regulation in epithelial cells, and modulation of T cell responses. The comparative study of Saguinus oedipus CD46 could reveal evolutionary conservation of these signaling mechanisms and potentially identify novel therapeutic targets for immune modulation .

What are the challenges and solutions in developing CD46-targeted therapeutics using insights from Saguinus oedipus CD46 research?

Developing CD46-targeted therapeutics presents both significant challenges and opportunities, with Saguinus oedipus CD46 research providing valuable insights:

Key Challenges:

Innovative Solutions:

  • Domain-Specific Targeting Approaches:

    • Development of monoclonal antibodies targeting specific epitopes mapped through comparative studies

    • Creation of decoy receptors based on critical binding domains identified in Saguinus oedipus CD46

    • Design of small molecule inhibitors targeting key protein-protein interaction sites

  • Leveraging Natural Variation:

    • Identification of naturally occurring CD46 variants with enhanced or reduced pathogen binding

    • Application of evolutionary insights to design therapeutics with minimal impact on complement regulation

    • Development of species-specific virus-vectored vaccines based on CD46 binding profiles

  • Translational Strategies:

    Therapeutic ApproachApplicationInsights from Saguinus oedipus Research
    Oncolytic virusesCancer treatmentIdentifying virus strains with optimal CD46 targeting
    Adenoviral vectorsGene therapy/vaccinesUnderstanding species-specific receptor usage
    Complement modulatorsInflammatory diseasesMapping functional domains for targeted inhibition

The study of Saguinus oedipus CD46 has already contributed to understanding the binding mechanisms of pathogens to CD46. This knowledge has informed the development of therapeutic vectors, including those used in COVID-19 vaccines. Further research could enhance the design of CD46-targeted therapeutics for inflammatory disorders and cancer while minimizing potential side effects .

How should researchers interpret variations in binding affinity data between recombinant Saguinus oedipus CD46 and different ligands?

Interpreting binding affinity data between recombinant Saguinus oedipus CD46 and various ligands requires careful consideration of multiple factors:

Key Considerations for Data Interpretation:

  • Expression System Impact:

    • E. coli-expressed CD46 lacks glycosylation, potentially altering binding properties

    • Insect cell-expressed protein may have different glycosylation patterns than native protein

    • Data should be interpreted in the context of the expression system used

  • Technical Variables Affecting Binding Data:

    • Buffer composition (ionic strength, pH, presence of divalent cations)

    • Temperature and incubation conditions

    • Protein concentration and potential aggregation

    • Detection method sensitivity and dynamic range

  • Biological Significance Assessment:

    KD RangeTypical InterpretationExample
    <10 nMHigh-affinity interactionStrong pathogen receptor binding
    10-100 nMModerate affinityTypical protein-protein interactions
    100-1000 nMLow affinityTransient regulatory interactions
    >1 μMVery low affinityMay not be physiologically relevant
  • Comparative Analysis Framework:

    • Always include human CD46 as a reference standard in binding studies

    • Compare data with published values for related proteins when available

    • Consider the biological context (e.g., cell surface density of CD46 may compensate for lower affinity)

When analyzing binding data for Saguinus oedipus CD46, researchers should account for these variables and avoid over-interpretation of absolute affinity values. Instead, focus on relative differences between ligands or between species variants, which often provide more reliable insights into biological significance. Research using Sf9 insect cells expressing measles virus hemagglutinin has demonstrated that this system provides a sensitive and quantifiable method for assessing binding interactions, allowing for comparative analysis between wild-type and mutant CD46 variants .

What controls and validation steps are essential when studying the complement regulatory functions of recombinant Saguinus oedipus CD46?

Rigorous controls and validation steps are crucial for obtaining reliable data on the complement regulatory functions of recombinant Saguinus oedipus CD46:

Essential Controls:

  • Positive Controls:

    • Purified human CD46 with established activity

    • Known complement regulatory proteins (e.g., Factor H, CD55)

    • Commercial complement inhibitors with defined potency

  • Negative Controls:

    • Heat-inactivated CD46 (to confirm activity loss)

    • Irrelevant proteins of similar size/structure

    • Buffer-only conditions

  • Specificity Controls:

    • Anti-CD46 blocking antibodies to confirm observed effects are CD46-dependent

    • Mutated CD46 variants lacking key functional domains

    • Competitive inhibition assays with known CD46 ligands

Validation Methodology:

  • Functional Assays for Factor I Cofactor Activity:

    • Western blot analysis of C3b/C4b cleavage products

    • ELISA-based detection of cleavage fragments

    • Flow cytometry to assess complement deposition on cell surfaces

  • Quality Control Checkpoints:

    • Confirmation of protein purity (>90% by SDS-PAGE)

    • Verification of proper folding (circular dichroism)

    • Assessment of glycosylation status (lectin blotting or mass spectrometry)

    • Endotoxin testing (particularly for functional immunological assays)

  • Quantitative Assessment Parameters:

    • Determination of EC50 values for complement inhibition

    • Calculation of cofactor activity relative to reference standards

    • Time-course analysis to evaluate kinetics of regulation

  • Cross-Validation Approaches:

    • Comparison of results from multiple assay formats

    • Verification in different cell systems

    • Correlation with structural data where available

Implementing these controls and validation steps ensures that observed effects can be confidently attributed to the complement regulatory functions of recombinant Saguinus oedipus CD46 rather than experimental artifacts or contaminants. This rigorous approach is particularly important when comparing species variants or evaluating the impact of mutations on regulatory function .

How can researchers reconcile conflicting data between in vitro and cell-based assays using recombinant Saguinus oedipus CD46?

Researchers often encounter discrepancies between in vitro biochemical assays and cell-based studies with recombinant CD46. Reconciling these differences requires systematic analysis:

Common Sources of Discrepancies:

  • Conformational Differences:

    • Soluble recombinant proteins may adopt different conformations than membrane-anchored forms

    • Lack of transmembrane domain can alter domain orientation and accessibility

    • Protein-lipid interactions at cell membranes may stabilize certain conformations

  • Complex Formation and Crowding:

    • Cell surface environment provides molecular crowding not replicated in vitro

    • Lateral interactions with other membrane proteins may affect function

    • Cytoskeletal associations can influence clustering and activity

  • Post-translational Modifications:

    • Differential glycosylation between expression systems

    • Cell-specific processing of CD46 (e.g., proteolytic cleavage)

    • Phosphorylation state of cytoplasmic domains

Reconciliation Strategies:

  • Bridging Experiments:

    • Use of membrane mimetics (liposomes, nanodiscs) to incorporate CD46 in a lipid environment

    • Step-wise complexity experiments (protein → liposome → cell)

    • Comparison of multiple cell types with varying CD46 expression levels

  • Technical Approaches:

    • Single-molecule imaging to assess protein behavior in different contexts

    • FRET-based assays to detect conformational changes

    • Cross-linking studies to identify interaction partners in cellular contexts

  • Interpretive Framework:

    ObservationPossible InterpretationResolution Approach
    Higher activity in vitroRemoval of inhibitory interactionsTest with purified potential inhibitors
    Higher activity in cellsMissing cofactors in vitroFractionation to identify cofactors
    Different ligand specificityConformational differencesStructural studies in different environments
  • Integrative Analysis:

    • Develop mathematical models that account for differences between systems

    • Identify parameters that best explain divergent results

    • Use computational approaches to predict behavior across different conditions

What emerging technologies could advance our understanding of Saguinus oedipus CD46 structure-function relationships?

Several cutting-edge technologies show promise for deeper exploration of Saguinus oedipus CD46 structure-function relationships:

Advanced Structural Biology Approaches:

  • Cryo-Electron Microscopy:

    • High-resolution structures of full-length CD46 in membrane environments

    • Visualization of conformational changes upon ligand binding

    • Structural analysis of CD46 in complex with multiple binding partners simultaneously

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Dynamic mapping of protein flexibility and conformational changes

    • Identification of allosteric effects upon ligand binding

    • Comparison of solution dynamics between species variants

  • NMR Spectroscopy:

    • Atomic-level dynamics of specific domains

    • Real-time monitoring of binding-induced structural changes

    • Analysis of intrinsically disordered regions (e.g., cytoplasmic tails)

Functional Genomics and Cellular Technologies:

  • CRISPR-Based Approaches:

    • Domain-specific mutagenesis at endogenous loci

    • CRISPRa/i for controlled expression of CD46 variants

    • Base editing for precise amino acid substitutions

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize CD46 clustering and organization

    • Single-molecule tracking to monitor diffusion and interaction dynamics

    • Lattice light-sheet microscopy for 3D visualization of CD46 behavior in living cells

  • Organoid and Advanced Cell Culture Systems:

    • Creation of Saguinus oedipus tissue-specific organoids expressing native CD46

    • Microfluidic systems to study CD46 under physiological flow conditions

    • Co-culture systems to examine cell-cell interactions mediated by CD46

The integration of these technologies could revolutionize our understanding of how CD46 structure relates to its diverse functions. For example, cryo-EM studies could reveal how pathogen binding to specific domains triggers conformational changes that alter complement regulatory activity, while CRISPR-based approaches could enable precise manipulation of endogenous CD46 to study isoform-specific functions in relevant cell types .

How might comparative studies between Saguinus oedipus and human CD46 inform therapeutic development for complement-mediated diseases?

Comparative studies between Saguinus oedipus and human CD46 offer valuable insights for therapeutic development targeting complement-mediated diseases:

Therapeutic Implications of Comparative Analysis:

  • Identification of Critical Functional Motifs:

    • Conserved regions across species likely represent essential functional elements

    • Species-specific variations may highlight adaptable regions amenable to therapeutic targeting

    • Natural mutations that enhance regulatory function could inspire protein engineering approaches

  • Development of Selective Inhibitors:

    • Structural differences in binding pockets between species guide selective drug design

    • Species-specific ligand binding properties inform development of targeted biologics

    • Understanding of differential regulation helps predict potential side effects

  • Disease-Specific Applications:

    Disease ContextComparative InsightTherapeutic Approach
    Atypical HUSIdentification of disease-resistant CD46 variantsProtein replacement therapy
    Inflammatory disordersSpecies differences in T cell modulationTargeted immunomodulatory agents
    CancerDifferential expression regulationTumor-selective CD46-targeting agents
    Infectious diseasesSpecies-specific pathogen bindingReceptor decoys or binding inhibitors
  • Translational Research Strategies:

    • Development of humanized animal models expressing human CD46

    • Creation of predictive in vitro systems incorporating species variants

    • Design of hybrid proteins combining beneficial features from multiple species

Over 60 disease-associated mutations in CD46 have been identified, mostly linked to atypical hemolytic uremic syndrome (aHUS). By comparing how these mutations affect the structure and function of human versus Saguinus oedipus CD46, researchers can gain insights into the molecular mechanisms of disease and identify potential therapeutic interventions. Additionally, understanding species-specific differences in pathogen binding could inform the development of broad-spectrum anti-infective strategies targeting conserved interaction mechanisms .

What are the potential applications of recombinant Saguinus oedipus CD46 in studying the evolution of host-pathogen interactions?

Recombinant Saguinus oedipus CD46 serves as a powerful tool for evolutionary studies of host-pathogen interactions:

Evolutionary Research Applications:

  • Molecular Archaeology of Host-Pathogen Arms Races:

    • Reconstruction of ancestral CD46 sequences to track evolutionary trajectories

    • Identification of positive selection signatures in specific domains

    • Correlation of structural adaptations with historical pathogen exposures

  • Cross-Species Transmission Barrier Analysis:

    • Experimental determination of binding affinities across primate CD46 variants

    • Identification of mutations required for successful cross-species transmission

    • Mapping of species-specific virus tropism determinants

  • Experimental Evolution Studies:

    • In vitro selection experiments with pathogens and different CD46 variants

    • Directed evolution of pathogens against Saguinus oedipus versus human CD46

    • Assessment of adaptive pathways and constraints in receptor usage

  • Methodological Approaches:

    • Ancestral sequence reconstruction and protein resurrection

    • Phylogenetic analysis of selection pressures across the CD46 gene

    • Creation of chimeric receptors representing evolutionary intermediates

    • High-throughput binding assays with pathogen libraries

Studies have already revealed significant evolutionary insights through comparative analysis of CD46 across primate species. For example, New World monkeys (including Saguinus oedipus) show deletions in the SCR1 domain that affect measles virus binding, suggesting evolutionary adaptations that may have shaped resistance patterns. The identification of naturally occurring variations that alter pathogen binding (such as the Arg103Gln mutation in baboon CD46) provides valuable information about the molecular determinants of host range and the selective pressures that have shaped CD46 evolution .

What strategies can researchers employ to overcome low expression yields of recombinant Saguinus oedipus CD46?

Researchers frequently encounter challenges with expression yields when producing recombinant Saguinus oedipus CD46. Several strategies can be implemented to improve protein production:

Expression System Optimization:

  • E. coli Expression Enhancement:

    • Codon optimization for E. coli preferred codons

    • Use of specialized strains (e.g., Rosetta for rare codons, Origami for disulfide bond formation)

    • Testing different fusion tags (SUMO, TrxA, GST) to improve solubility

    • Lower induction temperature (16-20°C) to reduce inclusion body formation

    • Expression as separate domains with subsequent reconstitution

  • Insect Cell System Improvements:

    • Optimization of multiplicity of infection (MOI) and harvest timing

    • Screen multiple signal sequences for secretion efficiency

    • Use of enhanced expression vectors with strong promoters

    • Supplementation with chemical chaperones to aid folding

    • Addition of protease inhibitors to prevent degradation

  • Mammalian Expression Strategies:

    • Transient vs. stable expression comparisons

    • Testing different cell lines (HEK293, CHO, ExpiCHO)

    • Development of inducible expression systems

    • Use of serum-free, protein-free media formulations

    • Implementation of perfusion culture systems

Construct Design Considerations:

  • Domain Engineering:

    • Expression of individual domains separately

    • Truncation of problematic regions while preserving function

    • Introduction of stabilizing mutations based on computational predictions

    • Careful design of domain boundaries based on structural knowledge

  • Optimization Parameters:

    ParameterStrategyExpected Outcome
    N-terminal sequenceTest multiple signal sequencesImproved translocation/secretion
    His-tag positionCompare N- vs. C-terminal tagsMinimized interference with folding
    Linker designFlexible vs. rigid linkersAppropriate domain orientation
    Removal of modification sitesMutation of protease cleavage sitesReduced degradation

How can researchers address potential contamination issues in functional assays using recombinant CD46?

Contamination in recombinant CD46 preparations can significantly impact functional assay results. Comprehensive strategies to address these issues include:

Prevention and Detection Methods:

  • Endotoxin Contamination:

    • Use of endotoxin-free reagents throughout purification

    • Implementation of Triton X-114 phase separation during purification

    • Endotoxin testing using LAL assay before functional studies

    • Inclusion of polymyxin B controls in cell-based assays

  • Host Cell Protein Contamination:

    • Multi-step purification strategies (IMAC followed by size exclusion/ion exchange)

    • Specific detection using anti-host cell protein antibodies

    • Mass spectrometry analysis to identify contaminants

    • Western blotting with multiple antibodies targeting different CD46 epitopes

  • Nucleic Acid Contamination:

    • Treatment with nucleases during purification

    • UV absorbance ratio (260/280 nm) monitoring

    • Specific testing for DNA content (PicoGreen assay)

    • Impact assessment using nuclease treatment controls

Functional Assay Considerations:

  • Control Strategies:

    • Parallel testing of different protein preparations

    • Dose-response curves to identify non-specific effects

    • Inclusion of specific inhibitors/blocking antibodies

    • Heat-inactivated protein controls

  • Assay-Specific Approaches:

    Assay TypeContamination ConcernMitigation Strategy
    Complement regulationProteasesAdd protease inhibitors, test with synthetic substrates
    T cell modulationEndotoxinInclude polymyxin B controls, endotoxin removal
    Binding assaysAggregatesSize exclusion chromatography pre-assay, dynamic light scattering
    Cell-based studiesMultiple contaminantsCompare different purification approaches
  • Validation Framework:

    • Cross-validation with commercial preparations when available

    • Comparison of results across multiple assay formats

    • Statistical analysis to distinguish specific from non-specific effects

    • Independent replication with different protein batches

The lyophilized powder form of recombinant Saguinus oedipus CD46 should undergo quality control testing before use in functional assays, including SDS-PAGE to confirm purity (>90%), endotoxin testing, and aggregation assessment. Proper reconstitution in appropriate buffers with stabilizers (such as 6% trehalose) can help maintain protein integrity and reduce non-specific effects in downstream applications .

What analytical techniques can help distinguish between proper folding and misfolding of recombinant Saguinus oedipus CD46?

Proper folding is crucial for the functional activity of recombinant Saguinus oedipus CD46. Several analytical techniques can help researchers assess protein folding status:

Structural Analysis Techniques:

  • Spectroscopic Methods:

    • Circular Dichroism (CD): Provides information about secondary structure content (α-helices, β-sheets)

    • Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence reveals tertiary structure changes

    • Fourier Transform Infrared Spectroscopy (FTIR): Complementary to CD for secondary structure analysis

    • Nuclear Magnetic Resonance (NMR): Detailed structural information at atomic resolution (for smaller domains)

  • Hydrodynamic Techniques:

    • Size Exclusion Chromatography (SEC): Separates properly folded protein from aggregates

    • Dynamic Light Scattering (DLS): Measures size distribution and detects aggregation

    • Analytical Ultracentrifugation (AUC): Provides information on shape, size, and heterogeneity

    • Thermal Shift Assays: Measures protein stability and can detect misfolding

  • Functional Indicators of Proper Folding:

    • Ligand Binding Assays: Properly folded protein should bind known ligands with expected affinity

    • Monoclonal Antibody Recognition: Conformation-specific antibodies can distinguish folded from misfolded protein

    • Limited Proteolysis: Correctly folded proteins show characteristic proteolytic patterns

    • Enzyme Activity Assays: For CD46, factor I cofactor activity serves as a functional readout

Analytical Decision Framework:

TechniqueInformation ProvidedWhen to Use
CD SpectroscopySecondary structure contentInitial assessment of folding
SEC-MALSMolecular weight, oligomeric stateQuality control before functional assays
Thermal ShiftStability, domain integrityComparing different preparation methods
Functional AssaysBiological activityFinal validation of proper folding

Interpretation Guidelines:

  • Complementary Approach: No single technique provides complete information; combine multiple methods

  • Reference Standards: Compare with well-characterized human CD46 preparations

  • Domain-Specific Analysis: Consider that individual domains may fold independently

  • Environmental Effects: Assess folding under different buffer conditions relevant to functional assays

For recombinant Saguinus oedipus CD46 expressed in E. coli, refolding protocols may be necessary to achieve proper conformation. The success of refolding can be monitored using these analytical techniques, with particular emphasis on functional assays that verify biological activity, such as factor I cofactor function or pathogen binding capabilities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.