Recombinant Saimiri boliviensis boliviensis Duffy antigen/chemokine receptor (DARC)
Shipped with Ice Packs 
In Stock 
Description
Malaria Pathogenesis Studies
-
DBP-DARC Interaction: Recombinant DARC is used to map binding domains of Plasmodium vivax Duffy Binding Protein (DBP). Critical residues for DBPII binding localize to a 170-amino acid region in DARC’s extracellular domain .
-
Invasion Mechanisms: Comparative transcriptomics in Saimiri vs. Aotus monkeys revealed DARC-independent invasion pathways in P. vivax, highlighting the utility of recombinant DARC in modeling alternative ligand-receptor interactions .
Chemokine Binding Profiling
-
Binding Affinity: Scatchard analysis shows high-affinity binding to IL-8 (KD = 20 ± 4.7 nM) and RANTES (KD = 33.9 ± 7 nM) .
-
Immune Modulation: Recombinant DARC internalizes chemokines but does not degrade them, suggesting a role in regulating chemokine gradients .
Comparative Analysis with Other Species
Recombinant DARC variants across species share structural homology but exhibit functional divergence:
Technical Considerations
Product Specs
Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare your order accordingly.
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ACKR1; DARC; FY; Atypical chemokine receptor 1; Duffy antigen/chemokine receptor; CD antigen CD234
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Target Names
Target Protein Sequence
MGNCLHQAELSPSTENSSQLNLEDLWNFSYNGNDSFPEIDYDASLAAAAPCHSCSLLNDS
SLPFFILASDLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPILAPGL
GNTHSSALCSLGYCVWYGSAFAQALLLGCHASLGPKLGAGQVPGLTLGLPVGLWGATALL
TLPITLASGASDGLCTPIYSTELEALQATHAVACFAIFVLLPLGLFGAKGLKKALGMGPG
PWMNILWVWFIFWWPHGLVLGLDFLVGSKLSLLPTCLAQQVLDLLLNLAEALAIVHCVAT
PLLLALFCHQTTRTLLPSLPLPERWSSPVDTLGSKS
Uniprot No.
Target Background
Function
DARC (Duffy antigen/chemokine receptor) is an atypical chemokine receptor that regulates chemokine levels and localization. It achieves this by binding chemokines with high affinity, but unlike classic ligand-driven signaling, this binding doesn't trigger signal transduction. Instead, it results in chemokine sequestration, degradation, or transcytosis. DARC is also known as interceptor (internalizing receptor), chemokine-scavenging receptor, or chemokine decoy receptor. DARC exhibits promiscuous chemokine-binding, interacting with inflammatory chemokines from both the CXC and CC subfamilies, but not with homeostatic chemokines. It acts as a receptor for various chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, and TARC. DARC regulates chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines, presenting them to circulating leukocytes; when expressed in erythrocytes, it acts as a blood reservoir for cognate chemokines and a chemokine sink, buffering potential surges in plasma chemokine levels.
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Subcellular Location
Early endosome. Recycling endosome. Membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
