Recombinant Saimiri boliviensis boliviensis Muscarinic acetylcholine receptor M5 (CHRM5)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Functional domains:

  • Orthosteric ligand-binding pocket formed by transmembrane helices III, V, VI, and VII .

  • Intracellular loops critical for Gq/11 protein coupling (residues 214–442) .

Sequence Information

  • Full-length construct: Residues 1–532 .

  • Critical regions: Partial constructs (e.g., residues 214–442) retain G-protein coupling activity .

Key Experimental Uses

  • Ligand-binding assays: Used to screen muscarinic agonists/antagonists (e.g., tiotropium) .

  • Structural studies: Supports crystallography for orthosteric/allosteric site analysis .

  • Signaling pathway analysis: Measures phosphoinositide hydrolysis and cAMP modulation .

Pharmacological Insights

  • Exhibits kinetic selectivity differences compared to human M5R due to sequence variations in transmembrane domains .

  • Couples preferentially to Gq/11 proteins, activating PLC-β and downstream Ca²⁺ signaling .

Functional and Clinical Relevance

  • Dopaminergic modulation: Implicated in reward pathways and substance addiction (e.g., cocaine, opioids) .

  • Stress response: Chronic stress alters M5R-mediated dopamine release kinetics in rodent models .

  • Therapeutic potential: Targeted for drug addiction treatment due to restricted CNS expression .

Challenges and Limitations

  • Species specificity: Functional differences exist between primate (Saimiri) and rodent M5R isoforms .

  • Stability issues: Repeated freeze-thaw cycles degrade activity; single-use aliquots recommended .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you require a particular tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
CHRM5; Muscarinic acetylcholine receptor M5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-532
Protein Length
full length protein
Species
Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Target Names
Target Protein Sequence
MEGDSYGNATTINGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPP DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSVSVTKAE KRKPAHRALFRSCFRCPRPTLVQRERNQASRSSSHRSTSITGKPSQATGPSTNWAKAEEL TTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEEAEETFVKGQTDKNDCDSPD YFLSPAAAHRPKSQQCVAYKFQLVVKADGTQETNNGCHKVKIMPCSFPVAKEPSTKGLSP NLSHQMTKRKRMVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVALWHLG YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCQWKKKKVEEKLYWQGNSKLP
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through the action of G proteins. The primary transducing effect is Pi turnover.
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM5 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of the Muscarinic Acetylcholine Receptor M5 (CHRM5)?

The M5 muscarinic acetylcholine receptor is one of five muscarinic receptor subtypes (M1-M5) and functions as a G protein-coupled receptor. The recombinant CHRM5 from Saimiri boliviensis boliviensis consists of 532 amino acids with a full sequence that includes a transmembrane domain structure typical of GPCRs . The receptor features critical regions for ligand binding within its orthosteric and allosteric sites. It is primarily expressed in dopamine-containing neurons of the substantia nigra pars compacta and ventral tegmental area, where it regulates the release of mesolimbic dopamine . The M5 receptor's amino acid sequence includes specific motifs that affect its binding properties and downstream signaling capabilities, with the full sequence containing various functional domains necessary for membrane insertion, ligand recognition, and signal transduction .

How does the CHRM5 receptor differ from other muscarinic receptor subtypes?

The M5 receptor differs from other muscarinic subtypes (M1-M4) in several key aspects. Recent high-resolution crystal structure determination has revealed important structural differences in both orthosteric and allosteric binding sites that could inform the rational design of selective ligands . While M2 and M3 receptors are more abundant in tissues like the bladder (with M2 outnumbering M3 in a 3:1 ratio), the M5 subtype has a more restricted distribution, primarily in the central nervous system's dopaminergic pathways . Unlike the M3 receptors that primarily mediate direct smooth muscle contraction, the M5 receptor has distinct functions in modulating dopamine release and reward pathways. These differences in location and function make M5 particularly relevant for addiction studies, as mice lacking functional M5R demonstrate reduced reward and withdrawal responses to substances like morphine and cocaine .

What storage and handling conditions are recommended for recombinant CHRM5?

For optimal stability and activity of recombinant CHRM5 protein, storage at -20°C is recommended for routine use, while long-term storage should be at -20°C or -80°C . The protein is typically supplied in a Tris-based buffer with 50% glycerol, which has been optimized to maintain protein stability . Researchers should avoid repeated freeze-thaw cycles as these can compromise protein integrity and activity. For ongoing experiments, working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw damage . When preparing experimental aliquots, it's advisable to use small volumes that will be consumed in a single experiment. The purified recombinant protein maintains its structure and function best when handled on ice during experimental preparations and when exposure to room temperature is minimized.

How can researchers utilize the crystal structure of M5 muscarinic receptor for structure-based drug design?

The high-resolution crystal structure of the human M5 muscarinic receptor bound to tiotropium provides a valuable template for structure-based drug design approaches . Researchers can leverage this structural information through several methodologies. First, comparative analysis across all five mAChR subtypes reveals key differences in both orthosteric and allosteric binding pockets that can be exploited for designing subtype-selective compounds . The structure enables computational approaches like molecular docking, virtual screening, and pharmacophore modeling to identify novel lead compounds. Researchers should focus on the extracellular loop regions where structural differences between subtypes are most pronounced, as these differences mediate ligand selectivity. The kinetic selectivity insights gained from chimeric swaps between M2 and M5 extracellular regions provide additional strategies for designing compounds with differential residence times . Sophisticated modeling techniques that incorporate protein dynamics, such as molecular dynamics simulations, can further refine drug candidates by accounting for receptor flexibility not captured in static crystal structures.

What are the implications of CHRM5 genetic variations on addiction research?

Genetic variations in the CHRM5 gene have significant implications for addiction research. Studies have identified several polymorphisms within the CHRM5 gene, including rs661968, rs7162140, and CHRM5b-257A>T, with varying frequencies in different populations . The rs7162140 polymorphism, located in the 5' untranslated region, has shown association with substance dependence behaviors and dosage patterns . Researchers investigating these variations should employ a comprehensive approach that includes:

  • Genotyping subjects for known CHRM5 polymorphisms using high-throughput methods

  • Correlating genotypes with addiction phenotypes using validated psychological and behavioral assessments

  • Conducting functional studies to determine how polymorphisms affect receptor expression or function

  • Designing translational studies that bridge animal models with human genetic findings

The theory-driven approach to candidate gene selection is particularly valuable in this context, as the biological role of M5R in controlling dopamine release duration provides a mechanistic link to addiction processes . Research indicates that M5R-deficient mice show substantially reduced reward and withdrawal responses to drugs of addiction, suggesting that genetic variations affecting M5R function in humans may similarly influence susceptibility to substance dependence .

How do experimental approaches using CHRM5 differ between in vitro and in vivo research contexts?

The experimental approaches for studying CHRM5 differ substantially between in vitro and in vivo contexts, each with distinct advantages and limitations. In vitro studies typically utilize recombinant protein systems, cell culture models expressing CHRM5, or membrane preparations containing the receptor. These approaches allow for precise measurement of binding kinetics, signal transduction, and molecular interactions . Researchers can employ techniques such as radioligand binding assays, ELISA-based detection, calcium flux assays, and receptor internalization studies to characterize receptor function and ligand interactions.

In contrast, in vivo approaches focus on physiological responses and behavioral outcomes in animal models. Knockout mouse models lacking functional M5R have been instrumental in demonstrating the receptor's role in addiction processes . These models allow researchers to assess complex behavioral phenomena such as drug self-administration, conditioned place preference, and withdrawal symptoms. Complementary techniques include microdialysis to measure neurotransmitter release, electrophysiology to record neuronal activity, and PET imaging with selective radiotracers to visualize receptor occupancy in living tissues.

Translational approaches that bridge these methodologies might include:

  • Using findings from in vitro screening to select compounds for in vivo testing

  • Validating mechanisms identified in animal models through human genetic studies

  • Developing biomarkers based on receptor function that can be measured in both contexts

What are the optimal experimental methods for assessing CHRM5 binding affinity and selectivity?

When assessing CHRM5 binding affinity and selectivity, researchers should implement a multi-faceted approach that combines complementary methodologies. Radioligand binding assays represent the gold standard for quantifying binding parameters, ideally using a selective radioligand with well-characterized properties. Saturation binding experiments determine Bmax (receptor density) and Kd (binding affinity), while competition binding assays measure the Ki values of test compounds. For selectivity profiling, researchers should test compounds against all five muscarinic receptor subtypes (M1-M5) expressed in identical systems to enable direct comparison.

Functional assays complement binding studies by measuring receptor activation consequences, including:

  • G-protein activation (GTPγS binding)

  • Second messenger production (cAMP or IP3)

  • β-arrestin recruitment

  • Receptor internalization

Kinetic binding experiments are particularly valuable for CHRM5, as evidence from crystal structure studies has revealed that kinetic selectivity (differential residence time) may be an important determinant of subtype selectivity . Time-resolved fluorescence resonance energy transfer (TR-FRET) assays can provide real-time binding kinetics data with high sensitivity. For compounds showing promising selectivity, cross-validation using multiple orthogonal assays increases confidence in the results and helps identify potential off-target interactions.

What experimental controls should researchers implement when studying CHRM5 in addiction models?

Rigorous experimental controls are essential when studying CHRM5 in addiction models to ensure valid and reproducible results. A comprehensive control strategy should include:

  • Genetic controls:

    • Use of littermate wild-type controls for comparison with CHRM5 knockout models

    • Inclusion of heterozygous models to assess gene-dosage effects

    • Implementation of tissue-specific or inducible knockout systems to distinguish developmental from acute effects

  • Pharmacological controls:

    • Inclusion of known selective and non-selective muscarinic ligands as reference compounds

    • Application of multiple concentrations to establish dose-response relationships

    • Use of structurally diverse compounds that act on the same target to distinguish on-target from off-target effects

  • Behavioral controls:

    • Measurement of locomotor activity to distinguish specific addiction-related behaviors from general motor effects

    • Assessment of natural reward processes to compare with drug rewards

    • Evaluation of learning and memory to control for cognitive confounds

  • Technical and procedural controls:

    • Randomization of treatment groups and blinding of experimenters

    • Inclusion of vehicle-treated controls for all experimental compounds

    • Consistent timing of procedures to control for circadian effects

When designing addiction studies utilizing CHRM5, researchers should be aware that mice lacking functional M5R show reduced reward and withdrawal responses following morphine and cocaine administration . This underscores the importance of including appropriate vehicle groups and dose-response designs when testing potential therapeutic compounds targeting this receptor system.

How can researchers optimize expression and purification of recombinant CHRM5 for structural and functional studies?

Optimizing expression and purification of recombinant CHRM5 for structural and functional studies presents several challenges due to its nature as a transmembrane protein. A systematically refined protocol should address the following key aspects:

Expression systems selection:

  • Mammalian expression systems (HEK293, CHO) maintain proper folding and post-translational modifications

  • Insect cell systems (Sf9, High Five) often yield higher protein quantities

  • Bacterial systems can be used for soluble domains but typically require fusion partners for full-length expression

Construct optimization:

  • Inclusion of affinity tags (His6, FLAG, or SNAP) for purification

  • Thermostabilizing mutations to enhance protein stability

  • Truncation of flexible regions that may impede crystallization

Solubilization and purification strategy:

  • Membrane preparation using differential centrifugation

  • Efficient solubilization using appropriate detergents (DDM, LMNG)

  • Two-step affinity purification followed by size exclusion chromatography

  • Quality control by SDS-PAGE, Western blot, and mass spectrometry

For structural studies, incorporation of a high-affinity ligand during purification often enhances stability, as demonstrated in the successful crystallization of M5 mAChR with tiotropium . Functional validation of the purified receptor through ligand binding assays ensures that the protein maintains its native conformation. Researchers should store the purified protein in a Tris-based buffer with 50% glycerol at -20°C or -80°C as recommended for the commercially available recombinant protein .

How does the function of CHRM5 differ between Saimiri boliviensis boliviensis and human models?

When conducting comparative studies, research indicates that while the orthosteric binding pocket (primary acetylcholine binding site) is highly conserved across species, greater variations exist in the allosteric binding regions and extracellular loops . These differences can significantly impact the binding profiles of selective compounds. The crystal structure of human M5 mAChR has revealed important insights into binding mechanisms that may not fully translate to the squirrel monkey receptor due to these subtle variations . Pharmacological studies have demonstrated that certain compounds show species selectivity, with different potency or efficacy profiles between primate species.

For translational research using Saimiri boliviensis CHRM5 as a model for human applications, researchers should perform careful comparative pharmacology studies to validate the relevance of findings across species. This is particularly important when developing therapeutic compounds targeting this receptor system for human conditions such as addiction, where species differences might affect drug efficacy or safety profiles.

What unique research applications exist for investigating the role of CHRM5 in addiction mechanisms?

The unique position of CHRM5 in mesolimbic dopamine pathways opens several innovative research applications for investigating addiction mechanisms. The receptor's role in regulating dopamine release duration makes it particularly valuable for studies focusing on reward persistence and drug-seeking behaviors . Researchers can leverage this understanding through several specialized approaches:

Optogenetic manipulation: By combining CHRM5 expression with optogenetic tools, researchers can achieve temporally precise control over receptor activity in specific neural circuits. This allows for investigation of how M5 receptor activation at different phases of addiction (acquisition, maintenance, withdrawal) influences behavioral outcomes.

Designer receptors exclusively activated by designer drugs (DREADDs): Modified muscarinic receptors that respond only to otherwise inert compounds enable selective activation or inhibition of CHRM5 signaling in vivo without affecting other muscarinic subtypes. This approach circumvents the challenge of developing highly selective M5 compounds.

Single-cell transcriptomics: Analysis of CHRM5 expression patterns at the single-cell level can reveal how drug exposure alters receptor expression in specific neuronal populations, providing insights into cellular adaptations underlying addiction.

Animal models have shown that M5R knockout mice display reduced self-administration of cocaine compared to wild-type controls, indicating its crucial role in maintaining drug reward behaviors . This makes CHRM5-targeted interventions particularly promising for addiction treatment research. Additionally, historical evidence suggesting that herbal extracts containing muscarinic receptor antagonists have been used in treating opium addiction provides an intriguing connection between traditional remedies and modern receptor pharmacology .

How can researchers integrate CHRM5 structural data with functional genomics for drug discovery applications?

Integrating CHRM5 structural data with functional genomics creates powerful synergies for drug discovery applications. The high-resolution crystal structure of M5 mAChR provides the spatial architecture of binding pockets and receptor conformation , while functional genomics offers insights into how genetic variations affect receptor expression, function, and disease associations . Researchers can implement an integrated workflow that combines these complementary approaches:

  • Structure-based virtual screening:

    • Use the M5 crystal structure to conduct in silico screening of compound libraries

    • Apply molecular docking techniques with scoring functions optimized for GPCRs

    • Filter compounds based on predicted interactions with subtype-specific residues

  • Genomics-guided target validation:

    • Analyze CHRM5 polymorphisms associated with addiction phenotypes (such as rs7162140)

    • Assess how these variations might alter receptor function or drug response

    • Prioritize drug development for genetic subpopulations most likely to benefit

  • Integration through computational models:

    • Develop systems biology models that incorporate both structural and genomic data

    • Simulate how genetic variations might alter drug binding or signaling pathways

    • Predict population-specific responses to potential therapeutic compounds

This integrated approach enables pharmacogenomic applications where treatment strategies can be tailored to individual genetic profiles. For example, understanding how the rs7162140 polymorphism affects CHRM5 function could help predict which patients might respond better to M5-targeted therapies for addiction . The combination of structural insights into ligand binding with genomic data on receptor variations creates opportunities for precision medicine approaches in treating conditions where CHRM5 plays a significant role.

What emerging technologies might advance CHRM5 research in neuropharmacology?

Several cutting-edge technologies are poised to revolutionize CHRM5 research in neuropharmacology. Cryo-electron microscopy (cryo-EM) offers the potential to capture multiple receptor conformational states, including active, inactive, and intermediate forms, providing dynamic insights beyond what crystal structures reveal . This would particularly benefit understanding of how different ligands induce distinct conformational changes in CHRM5. Nanobody development against specific CHRM5 conformations could stabilize these states for structural studies and potentially serve as highly selective tools for functional manipulation.

Chemogenetic approaches using engineered CHRM5 receptors that respond to otherwise inert ligands provide unprecedented specificity for investigating receptor function in vivo. These modified receptors can be expressed in specific neuronal populations to dissect circuit-level contributions to addiction behavior. Advanced imaging technologies like lattice light-sheet microscopy enable visualization of receptor trafficking and clustering with exceptional spatial and temporal resolution. This could reveal how CHRM5 redistribution contributes to neuroadaptations in addiction.

In the computational realm, artificial intelligence and machine learning algorithms trained on structural and functional data can accelerate the discovery of novel CHRM5-targeting compounds. These approaches can identify patterns in structure-activity relationships that might escape human analysis. Together, these technologies promise to overcome current limitations in selectivity, temporal control, and mechanistic understanding that have constrained CHRM5-based therapeutic development.

What are the key unanswered questions regarding CHRM5 function in reward pathways?

Despite significant advances in understanding CHRM5 biology, several critical questions regarding its function in reward pathways remain unanswered. A fundamental question concerns the precise cellular mechanisms by which M5 receptors modulate dopamine release duration rather than amplitude . This temporal aspect of neurotransmission control requires further investigation to understand how it translates to persistent reward-seeking behaviors. Similarly, the potential interactions between CHRM5 and other receptor systems in the same circuits, such as dopamine receptors or glutamate receptors, remain poorly characterized despite their likely importance in integrated signaling.

The cell type-specific roles of CHRM5 across different brain regions involved in reward processing need clarification. While studies have established its importance in midbrain dopamine neurons, its function in other neuron types and brain regions participating in reward circuitry remains unclear. The adaptations in CHRM5 signaling pathways following chronic drug exposure represent another critical knowledge gap. Understanding whether receptor density, coupling efficiency, or downstream signaling components change could reveal new intervention targets.

From a translational perspective, the predictive value of CHRM5 genetics for addiction vulnerability in humans requires further investigation. While animal studies clearly demonstrate its role in drug responses , how genetic variations in human CHRM5 contribute to addiction risk, treatment response, or relapse probability needs more extensive research with larger, well-characterized cohorts. Addressing these questions will significantly advance both basic understanding of reward neurobiology and clinical approaches to addiction treatment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.