ST7’s cytoplasmic domain interacts with proteins involved in:
Endocytosis: Mediates receptor internalization via adaptor proteins like Dab2 .
Signal Transduction: Binds to RACK1 (receptor for activated C kinase 1) and SARA (SMAD anchor for receptor activation) .
Recombinant ST7 is used to study:
Cancer Biology: Investigating its role in tumor progression and metastasis .
Signal Pathways: Elucidating interactions with SMAD and MAPK pathways .
Cross-Species Models: Human ST7 shares 95–98% homology with rodent and bovine orthologs, enabling comparative studies .
| Interactor Type | Count |
|---|---|
| Physical | 378 |
| Genetic | 15 |
| Network Nodes | 426 |
The ST7 (Suppressor of Tumorigenicity 7) protein is encoded by a tumor suppressor gene located in chromosome region 7q31.1-q31.2. It functions primarily in mediating tumor suppression through the regulation of genes involved in maintaining cellular structure and those involved in oncogenic pathways . The protein has been extensively studied in human cancer research, where it has been found to play a significant role in cell cycle regulation. The recombinant form from Saimiri boliviensis boliviensis (Bolivian squirrel monkey) is particularly valuable for comparative studies examining evolutionary conservation of tumor suppression mechanisms .
The recombinant ST7 protein from Saimiri boliviensis boliviensis consists of 585 amino acids and has a UniProt accession number of Q09YH4. The full protein sequence includes multiple transmembrane domains and functional regions that contribute to its tumor suppressive activities. The amino acid sequence is as follows:
MAEAGTGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAmLALLTHQFPELM GVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN
Research using cell cycle synchronization studies has demonstrated that ST7 expression levels fluctuate in relation to cell cycle progression. Specifically, both ST7 and SERPINE1 were found to be overexpressed when cells were arrested, while their expression diminished when cells re-entered cell division status . This pattern suggests that ST7 plays a role in regulating cell cycle checkpoints, potentially contributing to its tumor suppressor function by ensuring proper cell cycle control. Additionally, the same studies found that other cell cycle-related genes including Survivin, MMP-13, and Cyclin D1 were differentially expressed during various phases of the cell cycle, indicating a coordinated regulatory network involving ST7 .
Fluorescence studies using ST7 fusion proteins tagged with GFP, YFP, or V5 have shown that ST7 primarily exhibits cytosolic expression in various cancer cell lines including HCT-116, MCF-7, and PC-3 . Notably, ST7 translocation from the cytoplasm to the nucleus has not been observed under any of the experimental conditions tested, suggesting that its tumor suppressive functions may be primarily mediated through cytoplasmic signaling pathways rather than direct nuclear interactions . This cytosolic localization provides important insights for researchers designing experiments to study ST7 function and interactions.
To effectively study functional interactions of recombinant ST7 protein, researchers should consider a multi-faceted approach combining several methodologies:
Expression vector systems: Gateway cloning systems have been successfully used to create various types of ST7 expression vectors tagged with GFP, YFP, or V5 sequences. These tagged constructs allow for effective visualization and tracking of the protein in cellular systems .
Cell cycle synchronization: This technique has proven valuable for analyzing endogenous ST7 expression patterns in relation to cell cycle progression. Methods such as serum starvation, thymidine block, or nocodazole treatment can be employed to arrest cells at specific cycle stages, followed by measurement of ST7 expression levels .
Co-immunoprecipitation coupled with mass spectrometry: This approach can identify protein-protein interactions involving ST7, potentially revealing binding partners relevant to its tumor suppressor function.
Cellular localization studies: Fluorescence microscopy using tagged ST7 constructs can determine subcellular localization patterns under various experimental conditions, though previous research has consistently shown cytosolic expression without nuclear translocation .
When working specifically with recombinant Saimiri boliviensis boliviensis ST7 protein, researchers should store the protein at -20°C in Tris-based buffer with 50% glycerol. For extended storage, -80°C is recommended to maintain protein stability and functionality .
When conducting comparative studies involving ST7 from different Saimiri species, accurate species identification is crucial. Molecular techniques focusing on species-specific genetic markers have proven most reliable for this purpose. Research has identified 51 polymorphic Alu insertions with species-informative distribution patterns between Saimiri sciureus and Saimiri boliviensis .
These genetic markers show clear differentiation, with the Saimiri boliviensis group demonstrating an allele frequency of 80-100% for these insertions, while the Saimiri sciureus group shows a significantly lower frequency of 0-20% on average . The table below illustrates the distribution of several representative Alu insertion markers across species:
| Alu Locus Name | S. sciureus Frequency | S. boliviensis Frequency |
|---|---|---|
| L-20858-sf38 | 0.000 | 0.893 |
| L-40335-subfam32 | 0.000 | 0.893 |
| L-21370-subfam26 | 0.083 | 1.000 |
| L-16089-Subfam26 | 0.167 | 1.000 |
| L-27488-subfam4 | 0.167 | 1.000 |
| L-29927-Subfam4 | 0.150 | 0.964 |
Researchers should employ PCR-based genotyping of these Alu insertions to confirm species identity when working with specimens or cell lines from various sources, ensuring experimental rigor in comparative studies of ST7 function .
Studies examining ST7 mutations across various cancer types have revealed several important patterns:
These findings have important implications for recombinant protein studies. Researchers should consider:
Testing whether specific ST7 variants affect protein function or stability
Comparing wild-type and mutant forms in functional assays
Examining whether polymorphisms affect interaction patterns with other proteins
When designing experiments using recombinant ST7, researchers should be aware that the functional consequences of these genetic variations remain incompletely understood and merit further investigation through carefully designed comparative studies .
To effectively investigate relationships between ST7 and other cancer-related genes, researchers should employ several complementary experimental approaches:
Cell cycle synchronization studies: This methodology has successfully demonstrated coordinated expression patterns between ST7, SERPINE1, and other cell cycle regulators including Survivin, MMP-13, and Cyclin D1 . Researchers can arrest cells at specific cell cycle stages using methods such as double thymidine block or nocodazole treatment, then measure expression levels of ST7 and potential target genes through RT-qPCR or western blotting.
Gene expression correlation analysis: Examining expression patterns of ST7 and other cancer-related genes across large datasets (such as TCGA) can reveal statistically significant correlations that suggest functional relationships.
Knockdown/overexpression experiments: Manipulating ST7 expression levels through siRNA knockdown or plasmid-based overexpression, followed by transcriptome analysis, can identify genes whose expression changes in response to altered ST7 levels.
Chromatin immunoprecipitation (ChIP): For genes potentially regulated by ST7, ChIP experiments can determine whether ST7 directly or indirectly associates with promoter regions of these target genes.
Research has specifically shown that ST7 appears to mediate tumor suppression through regulation of genes involved in maintaining cellular structure and those participating in oncogenic pathways . The observed inverse relationship between ST7/SERPINE1 expression and cell division status provides a valuable experimental framework for further investigations of these regulatory relationships .
Proper storage and handling of recombinant ST7 protein is critical for maintaining its stability and biological activity. According to manufacturer specifications, the following conditions should be observed:
Short-term storage: Working aliquots should be stored at 4°C for no longer than one week .
Standard storage: Store at -20°C in the provided Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein .
Extended storage: For long-term preservation, -80°C is recommended to minimize degradation .
Handling precautions: Repeated freezing and thawing cycles should be strictly avoided as they significantly compromise protein integrity. Instead, researchers should create single-use aliquots upon initial thawing of the stock solution .
Working concentration: The typical working quantity is 50 μg, though other quantities may be available upon request for specific experimental needs .
By adhering to these storage and handling guidelines, researchers can ensure optimal performance of the recombinant protein in downstream applications and experimental procedures.
Validating the functional activity of recombinant ST7 protein requires a multi-step approach to ensure both identity and biological activity:
Western blot verification: Confirming the correct molecular weight and immunoreactivity using anti-ST7 antibodies provides initial validation of protein identity.
Cellular localization assay: Properly functioning ST7 should demonstrate cytosolic localization when introduced into appropriate cell lines. Previous research has confirmed cytosolic expression in HCT-116, MCF-7, and PC-3 cancer cell lines through fluorescence detection of fusion proteins .
Cell cycle effect assessment: Functional ST7 should influence expression of specific cell cycle-related genes. Researchers can measure levels of known ST7-responsive genes such as SERPINE1, Survivin, MMP-13, and Cyclin D1 following introduction of recombinant ST7 .
Tumor suppression assays: As ST7 functions as a tumor suppressor, researchers can assess its activity through cell proliferation assays, colony formation assays, or soft agar growth assays using cancer cell lines with low endogenous ST7 expression.
Binding partner validation: Co-immunoprecipitation experiments can confirm that recombinant ST7 maintains the ability to interact with known protein partners, providing evidence of proper folding and functional capacity.
Each of these validation approaches provides complementary evidence that the recombinant protein maintains both structural integrity and biological activity, essential considerations for meaningful experimental outcomes.
When investigating ST7's impact on gene expression patterns, several critical controls must be incorporated to ensure rigorous and reproducible results:
Empty vector controls: When using expression vectors for ST7 delivery, parallel experiments with the identical vector lacking the ST7 insert are essential to distinguish ST7-specific effects from vector-induced changes.
Mutant ST7 controls: Including non-functional ST7 mutants helps differentiate between specific effects of ST7 activity versus mere presence of the protein.
Cell type controls: Since ST7 has been studied in multiple cancer cell lines (HCT-116, MCF-7, PC-3), researchers should include different cell types to identify cell-specific versus universal effects of ST7 .
Time-course sampling: As ST7 expression varies during cell cycle progression, temporal controls are crucial. Collection of samples at multiple time points can capture dynamic changes in gene expression patterns .
Endogenous ST7 assessment: Measurement of baseline endogenous ST7 levels in experimental cell lines is necessary to properly interpret the effects of introducing additional recombinant protein.
Cell cycle phase controls: Since both ST7 and SERPINE1 show altered expression when cells transition between arrested and dividing states, researchers should implement cell synchronization protocols to control for cell cycle phase variation .
Comparative analysis of ST7 protein between Saimiri boliviensis boliviensis and humans provides valuable insights into evolutionary conservation of tumor suppressor mechanisms. While specific differences in amino acid sequence exist between these species, the core functional domains and motifs of ST7 demonstrate significant conservation, suggesting fundamental importance to cellular regulation.
The amino acid sequence of Saimiri boliviensis boliviensis ST7 (UniProt: Q09YH4) includes specialized regions that maintain the protein's tumor suppressive capabilities while potentially exhibiting species-specific regulatory mechanisms . Researchers investigating cancer-related pathways should consider:
Conserved domains: Identify which functional regions show highest conservation between human and squirrel monkey ST7, as these likely represent evolutionarily critical components of tumor suppression mechanisms.
Divergent regions: Areas of sequence divergence may represent species-specific adaptations or regulatory mechanisms that could provide insights into novel approaches for cancer intervention.
Functional equivalence testing: Experiments comparing the ability of human versus Saimiri boliviensis boliviensis ST7 to suppress oncogenic phenotypes in various cell models can reveal whether tumor suppression mechanisms are fully conserved or exhibit species-specific variations.
The study of ST7 across different primate species provides a valuable evolutionary perspective on tumor suppressor function that may ultimately contribute to more comprehensive understanding of cancer development and potential therapeutic strategies.
Accurate authentication of Saimiri boliviensis boliviensis samples is crucial for maintaining experimental rigor in ST7 protein research. Molecular genetic markers, particularly Alu insertions, provide highly reliable species identification. Research has identified 51 polymorphic Alu insertions that display species-informative distribution patterns .
The most definitive genetic markers show the following characteristics:
Present at 80-100% frequency in Saimiri boliviensis samples
Generally absent (0-20% frequency) in Saimiri sciureus samples
Represent 26 different Alu subfamilies, including 10 Saimiri lineage-specific subfamilies
A subset of particularly discriminative markers is shown below:
| Alu Locus | S. boliviensis Frequency | S. sciureus Frequency |
|---|---|---|
| L-24998-subfam36 | 1.000 | 0.000 |
| L-40504-sf42 | 1.000 | 0.167 |
| L-13945-sf46 | 1.000 | 0.042 |
| L-2485-sf82 | 1.000 | 0.042 |
| L-38773-sf44 | 1.000 | 0.167 |
Researchers should implement PCR-based genotyping using primers targeting these Alu insertions to verify the species identity of any samples used for ST7 protein isolation or study. This authentication step is particularly important when working with archival samples or those from captive colonies where potential hybridization might occur .
Production and purification of recombinant ST7 protein presents several technical challenges that researchers should anticipate and address:
Protein solubility: The ST7 protein contains hydrophobic regions that can affect solubility during expression and purification. Using optimized buffer systems containing 50% glycerol helps maintain protein solubility .
Expression system selection: The choice between prokaryotic versus eukaryotic expression systems significantly impacts protein folding and post-translational modifications. For functional studies, mammalian expression systems may better preserve ST7's native characteristics despite lower yield.
Tag interference: While protein tags facilitate purification and detection, they may interfere with ST7 function or localization. The tag type should be determined during the production process based on specific experimental needs .
Protein stability: ST7 demonstrates sensitivity to repeated freeze-thaw cycles, necessitating careful aliquoting and storage protocols. Working aliquots should be maintained at 4°C for no longer than one week .
Purification complexity: Multi-step purification strategies may be required to achieve high purity while maintaining protein activity, potentially including affinity chromatography followed by size exclusion or ion exchange techniques.
Activity verification: Confirming that the recombinant protein retains proper function after purification requires carefully designed functional assays based on ST7's known tumor suppressor activities.
Addressing these challenges requires careful optimization of expression conditions, purification protocols, and storage methods to ensure that the final product accurately represents the native protein's characteristics.
Designing robust experiments to investigate ST7's tumor suppression mechanisms requires careful consideration of multiple factors:
Model system selection: Choose appropriate cell lines that demonstrate relevant oncogenic phenotypes while lacking or having low endogenous ST7 expression. Previous research has successfully utilized HCT-116, MCF-7, and PC-3 cancer cell lines .
Expression strategy optimization: Consider both transient and stable expression systems, with appropriate controls including empty vectors and mutant ST7 variants to distinguish specific effects.
Cellular localization monitoring: Incorporate fluorescent tags (GFP, YFP) or epitope tags (V5) to track ST7 localization within cells, confirming the expected cytosolic distribution pattern .
Cell cycle synchronization: Implement protocols to arrest cells at specific cell cycle phases, allowing precise examination of ST7's impact on cell cycle progression and related gene expression patterns .
Downstream target analysis: Design comprehensive approaches to identify genes regulated by ST7, combining transcriptome analysis with targeted validation of specific candidates like SERPINE1, Survivin, MMP-13, and Cyclin D1 .
Functional outcome measurement: Incorporate assays measuring relevant cancer-related phenotypes, such as proliferation rates, migration capacity, invasion potential, or anchorage-independent growth.
Pathway integration analysis: Utilize pathway analysis tools to contextualize experimental findings within broader oncogenic signaling networks, helping to position ST7's role relative to established cancer pathways.
By implementing this multifaceted experimental design approach, researchers can generate comprehensive insights into ST7's specific contributions to tumor suppression mechanisms.
Current research on ST7 is expanding in several innovative directions that promise to deepen our understanding of this tumor suppressor's biological significance:
Cross-species functional conservation: Comparative studies examining ST7 function across different species, including Saimiri boliviensis boliviensis, are providing evolutionary insights into the conservation of tumor suppression mechanisms .
Mechanistic pathway elucidation: Advanced research is moving beyond correlative studies to determine the precise molecular mechanisms through which ST7 regulates genes involved in cellular structure maintenance and oncogenic pathways .
Clinical significance assessment: Emerging studies are evaluating the potential diagnostic, prognostic, and therapeutic implications of ST7 expression patterns in various cancer types, particularly in light of the observation that mutations in ST7 appear relatively rare in primary colorectal, gastric, and hepatocellular carcinomas .
Cell cycle checkpoint regulation: Building on observations that ST7 expression is elevated during cell cycle arrest and diminishes during cell division, researchers are investigating ST7's specific roles in checkpoint regulation and how these functions contribute to tumor suppression .
Interaction network mapping: Proteomics approaches are being employed to comprehensively map ST7's protein interaction network, providing a more complete picture of how this tumor suppressor integrates into broader cellular signaling systems.
These emerging research directions collectively promise to provide a more comprehensive understanding of ST7's biological roles and potential clinical significance in cancer biology.
The apparent contradiction between ST7's classification as a tumor suppressor and the relative rarity of inactivating mutations in various cancers presents an intriguing research challenge requiring nuanced investigative approaches:
Alternative inactivation mechanisms: Researchers should explore whether ST7 function is compromised through mechanisms other than coding mutations, such as epigenetic silencing, post-translational modifications, or disruption of regulatory elements. This might explain why truncating mutations appear rare in primary colorectal, gastric, and hepatocellular carcinomas despite evidence supporting ST7's tumor suppressor role .
Context-dependent function: Design experiments to test whether ST7's tumor suppressor activity may be tissue-specific or dependent on particular cellular contexts, potentially explaining variable mutation patterns across cancer types.
Non-classical tumor suppressor models: Investigate whether ST7 might function through non-canonical tumor suppression mechanisms that do not conform to the traditional two-hit hypothesis, which would align with the observation that germline mutations or rare polymorphisms rather than somatic changes have been identified .
Comprehensive mutation analysis: Implement more sensitive detection methods across larger and more diverse sample cohorts, as current studies may have missed subtle or less common mutational patterns. The single nucleotide substitution identified in both colon cancer and the breast cancer cell line MDA-MB-435 warrants functional characterization to determine its significance .
Functional consequences of SNPs: Design experiments to assess whether the four identified SNPs in the ST7 gene locus, despite lacking clear correlations with clinicopathological data, might have subtle functional impacts that contribute to cancer development in specific contexts .
By pursuing these complementary investigative approaches, researchers may reconcile the apparent contradictions in ST7 mutation data and develop a more nuanced understanding of this gene's role in cancer biology.