Recombinant Saimiri oerstedii Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

Recombinant Saimiri oerstedii Melanocyte-Stimulating Hormone Receptor (MC1R) is a laboratory-engineered protein derived from the MC1R gene of the Central American squirrel monkey (Saimiri oerstedii). This G protein-coupled receptor (GPCR) regulates melanogenesis by binding α-melanocyte-stimulating hormone (α-MSH) and adrenocorticotropic hormone (ACTH), activating cAMP-dependent pathways that influence pigmentation and UV-induced DNA repair . Its recombinant form enables mechanistic studies of melanocortin signaling across primate species.

  • Ligand Binding: Binds α-MSH, β-MSH, and ACTH with nanomolar affinity, activating adenylate cyclase to elevate intracellular cAMP .

  • Melanin Regulation: Stimulates eumelanin synthesis via cAMP/PKA signaling, counteracted by agouti signaling protein (ASIP) .

  • DNA Repair: Enhances nucleotide excision repair (NER) by promoting PTEN stability, reducing UV-induced mutagenesis .

Key Mutational Effects:

  • R142C and R217H substitutions impair PTEN binding, increasing melanoma risk in red-haired phenotypes .

  • C35A mutation disrupts disulfide bonds, abolishing receptor trafficking to the plasma membrane .

Table 2: Experimental Uses of Recombinant MC1R

ApplicationMethodologyKey FindingsSource
Ligand InteractionSurface Plasmon ResonanceIdentified ASIP as a competitive antagonist of α-MSH
Signaling PathwayscAMP ELISAQuantified 5x higher cAMP in WT vs. RHC mutants
Melanoma StudiesCo-IP/Western BlotDemonstrated MC1R-PTEN complex disruption in BRAF-mutant cells

Biotechnological Production

The protein is synthesized using codon-optimized vectors in multiple systems:

  • Bacterial: High-yield expression in E. coli (1–5 mg/L) .

  • Baculovirus: Post-translational modifications in insect cells .

  • Mammalian: Full-length glycosylated forms in HEK293 cells .

Comparative Analysis Across Primates

  • Melanoma Susceptibility: Loss-of-function MC1R variants (e.g., R151C, R160W) reduce cAMP signaling by 70%, increasing UV-induced DNA damage .

  • Therapeutic Targets: PI3K/Akt inhibitors (e.g., alpelisib) show efficacy in MC1R/BRAF-mutant melanomas .

Future Directions

  • Cryo-EM Studies: Resolve full-length MC1R structure bound to α-MSH/ASIP.

  • Gene Therapy: Delivery of WT MC1R via adenovirus to restore PTEN function in RHC melanocytes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Saimiri oerstedii (Central American squirrel monkey)
Target Names
Target Protein Sequence
MPIHGAPRKLLGSLNSTPTATPKLGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLEMAVVLLLEGGALATRASVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRHISIFYALRYHSIMTLPRAQRVIAAIWVASILSSTLFI TYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGITRLHKRQPPAHQGFGLRGA ATLTILLGIFFLCWGPFFLHLKLVVFCPQHLTCSCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function
Melanocyte-stimulating hormone receptor (MC1R) is a receptor for MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. MC1R plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), through regulation of cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of MC1R and how does it compare across species?

MC1R is a seven-pass transmembrane G-protein coupled receptor consisting of 317 amino acids in humans. It functions primarily by coupling to Gs proteins to activate adenylyl cyclase and generate cAMP as a second messenger. The Saimiri oerstedii (Central American squirrel monkey) MC1R shares significant homology with human MC1R, making it a valuable comparative model .

The receptor's structure includes important functional domains:

  • An extracellular N-terminal region

  • Seven transmembrane domains

  • Three extracellular loops

  • Three intracellular loops

  • A cytoplasmic C-terminal tail

When investigating MC1R structure-function relationships, researchers should consider employing techniques such as site-directed mutagenesis, co-immunoprecipitation, and fluorescence resonance energy transfer (FRET) to determine critical binding domains and signaling interfaces .

How does MC1R signaling cascade function at the molecular level?

MC1R signaling is initiated upon binding of its primary agonist α-melanocyte stimulating hormone (α-MSH), leading to conformational changes that activate G-protein signaling. The primary signaling pathway involves:

  • Activation of adenylyl cyclase following α-MSH binding

  • Increased production of intracellular cAMP

  • Activation of protein kinase A (PKA)

  • Phosphorylation of cAMP response element-binding protein (CREB)

  • Upregulation of microphthalmia-associated transcription factor (MITF)

  • Enhanced expression of genes involved in melanogenesis and DNA repair

Importantly, MC1R signaling also promotes DNA repair through:

  • Increased phosphorylation of ATR at S435

  • Enhanced recruitment of XPA to sites of DNA damage

  • Increased expression of DNA repair genes

  • Activation of p53 signaling via phosphorylation at S15

For effective investigation of MC1R signaling, researchers should implement cAMP assays, phospho-protein analysis by western blotting, and chromatin immunoprecipitation to track transcriptional changes downstream of receptor activation.

What is the significance of oligomerization in MC1R function?

MC1R undergoes constitutive dimerization without requiring ligand binding, and this occurs primarily at the endoplasmic reticulum level. When investigating MC1R dimerization, several key considerations emerge:

  • Dimerization involves both covalent and non-covalent interactions

  • Four specific inter-subunit disulfide bonds (C35, C267, C273, and C275) are critical

  • The C35 residue is specifically required for MC1R trafficking from ER to plasma membrane

  • Heterogeneous receptor dimerization can have significant functional consequences:

    • Mutant-wildtype dimerization can create dominant negative effects

    • Co-expression of complementary mutants may rescue function if mutations are in different domains

Methodologically, researchers studying MC1R oligomerization should employ techniques such as:

  • Non-reducing SDS-PAGE to preserve disulfide bonds

  • Co-immunoprecipitation with differentially tagged MC1R constructs

  • FRET or bioluminescence resonance energy transfer (BRET) to assess protein-protein interactions

  • Confocal microscopy to visualize receptor localization and trafficking

What methodologies are most effective for studying MC1R-dependent DNA repair mechanisms?

MC1R activation enhances DNA repair via multiple mechanisms. To study these processes, researchers should employ a systematic approach using three complementary assays:

  • Quantification of ATR-pS435 levels:

    • Western blotting using phospho-specific antibodies

    • Immunofluorescence to visualize nuclear localization

  • Assessment of repair of UV-damaged oligonucleotides:

    • Host cell reactivation assays

    • In vitro repair assays with cell extracts from MC1R-expressing cells

  • Analysis of recruitment of XPA and ATR-pS435 to damaged DNA:

    • Chromatin immunoprecipitation

    • Live-cell imaging with fluorescently tagged repair proteins

This toolkit allows comprehensive evaluation of how MC1R signaling impacts DNA repair capabilities, particularly relevant when comparing wild-type versus variant MC1R functions or when testing potential preventive agents that might enhance impaired MC1R functions.

How can researchers effectively assay MC1R ligand interactions?

MC1R signaling is modulated by interactions with three primary ligands: melanocortins (agonists), agouti signaling protein (ASIP, inverse agonist), and β-defensin 3 (βD3, neutral antagonist). To study these interactions:

  • Melanocortin (α-MSH) binding and activation:

    • Competitive binding assays with radiolabeled melanocortins

    • cAMP accumulation assays using ELISA or FRET-based sensors

    • ERK phosphorylation via western blotting

    • Calcium mobilization using fluorescent indicators

  • ASIP inhibition studies:

    • Measurement of basal and stimulated cAMP levels in presence of ASIP

    • Competitive binding assays with labeled α-MSH and unlabeled ASIP

    • Functional antagonism assessment through melanin quantification

  • βD3 antagonism analysis:

    • Competitive binding without effects on basal cAMP

    • Blockade of both α-MSH and ASIP binding

    • Quantification of melanin production

It's important to note that ASIP, despite having no sequence similarity to melanocortins, binds to MC1R with nearly equal affinity through its cysteine-rich C-terminal region via an octaloop structure. The C-terminal region alone can function as a competitive antagonist .

What are the pleiotropic effects of MC1R beyond pigmentation, and how can they be studied?

MC1R functions extend well beyond melanogenesis, with significant impacts on:

  • DNA repair:

    • Enhanced nucleotide excision repair (NER)

    • Improved base excision repair

    • Reduction of UV-induced oxidative stress

    • To study: Use comet assays, immunostaining for CPD/6-4PP photoproducts, and host cell reactivation assays

  • Immune responses:

    • Anti-inflammatory effects

    • Modulation of cytokine production

    • To study: Analyze cytokine profiles, immune cell activation markers, and inflammatory responses in MC1R variant vs. wild-type models

  • Analgesia:

    • Altered pain perception

    • To study: Compare pain responses in animal models with different MC1R variants

  • Embryonic development:

    • Widespread expression in nervous and musculoskeletal systems

    • To study: Perform comprehensive expression analysis using in situ hybridization, RT-PCR, and immunohistochemistry across developmental stages

  • Possible influence on birth weight:

    • Initial studies suggested associations between MC1R variants (particularly R151C) and birth weight

    • Further investigation with larger cohorts did not reproduce this finding

    • To study: Conduct large-scale genotype-phenotype association studies with appropriate controls for known birth weight modifiers

When investigating these pleiotropic effects, researchers should employ both in vitro and in vivo models, comparing wild-type MC1R with natural variants to determine how receptor function correlates with these diverse biological processes.

How can researchers distinguish between MC1R-dependent and MC1R-independent effects in experimental models?

Distinguishing between effects directly attributable to MC1R signaling versus indirect or independent mechanisms requires rigorous experimental design:

  • Genetic approaches:

    • Use of MC1R knockout models

    • CRISPR/Cas9-mediated introduction of specific variants

    • siRNA-mediated knockdown with rescue experiments using wild-type or variant MC1R

  • Pharmacological approaches:

    • Selective MC1R agonists (α-MSH analogs)

    • Specific antagonists (ASIP C-terminal peptides)

    • Comparison with pan-melanocortin receptor agonists

  • Signaling pathway analysis:

    • Use of specific PKA inhibitors (e.g., H-89)

    • cAMP analogues to bypass receptor activation

    • Assessment of pathway-specific transcriptional responses

  • Control experiments:

    • Parallel studies in MC1R-expressing versus non-expressing cell types

    • Comparison of related cell lines with different endogenous MC1R expression levels

    • Time-course analyses to distinguish primary from secondary effects

By systematically applying these approaches, researchers can more confidently attribute observed phenotypes to MC1R-dependent mechanisms versus alternative pathways.

What unexplored aspects of MC1R biology warrant further investigation?

Several promising research avenues remain underexplored:

  • Developmental roles of MC1R beyond melanocytes:

    • Investigation of MC1R function in embryonic nervous and musculoskeletal systems

    • Potential influence on tissue patterning and organ development

    • Comparative analysis across species to identify conserved developmental functions

  • MC1R in non-melanoma contexts:

    • Expression and function in immune cells

    • Role in neuronal tissues and pain modulation

    • Potential functions in other organ systems

  • Interaction with other signaling pathways:

    • Cross-talk with Wnt signaling

    • Integration with inflammatory pathways

    • Relationship to p53 activation beyond DNA damage responses

  • Novel therapeutic applications:

    • Development of biased agonists that selectively activate beneficial pathways

    • MC1R-targeted drug delivery systems

    • Manipulation of MC1R signaling to enhance DNA repair in high-risk populations

Researchers interested in these areas should consider employing tissue-specific conditional knockout models, high-throughput screening for pathway interactions, and advanced imaging techniques to visualize MC1R activity in living systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.