Recombinant Saimiriine herpesvirus 2 Transforming protein STP (1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Saimiriine herpesvirus 2 Transforming Protein STP(1)

Recombinant Saimiriine herpesvirus 2 Transforming protein STP(1), also referred to as STP-C488, is a viral oncoprotein crucial for the transforming activity of Herpesvirus saimiri (HVS) . HVS, specifically group C strains, can transform human and simian T-lymphocyte populations into permanent, antigen-independent growth . The protein is not required for viral replication, but it is essential for transformation .

Production and Detection

  • Antibody Production Antibodies against STP-C488 can be produced in rabbits by immunizing them with keyhole limpet hemocyanin-conjugated synthetic peptides specific to the predicted STP-C488 sequence .

  • Detection Methods The STP-C488-encoded protein can be detected in various cell types, including recombinant Escherichia coli, transformed Rat-1 cells, transfected COS-1 cells, and common marmoset T lymphocytes immortalized by HVS strain 488 .

Cellular Interactions and Signaling Pathways

  • Interaction with Ras STP-C488 associates with cellular Ras proteins in transformed cells . Mutations disrupting this association impair the transforming ability of the STP-C488 oncogene . STP-C488 can compete with Raf-1 for binding to Ras, activating the Ras signaling pathway, increasing the Ras-GTP to Ras-GDP ratio, and constitutively activating mitogen-activated protein kinase (MAPK) .

  • Downstream Effects Expression of STP-C488 induces Ras-dependent neurite outgrowth in PC12 cells, indicating that STP-C488 can mediate oncogenic transformation by associating with cellular Ras .

Functional Studies and Recombinant Viruses

  • STP Replacement Studies Experiments have been conducted where the STP-C488 oncogene was replaced with cellular normal Ras (c-Ras) or viral oncogenic Ras (v-Ras) in recombinant strains of HVS C488 . Recombinant HVS deltaSTP/v-Ras immortalized primary common marmoset T lymphocytes to interleukin-2-independent growth as efficiently as wild-type HVS C488, whereas recombinant HVS deltaSTP/c-Ras did so with lower efficiency .

  • Phenotypic Changes Cells immortalized with HVS deltaSTP/c-Ras and HVS deltaSTP/v-Ras were primarily CD4+ CD8+ double-positive T lymphocytes, unlike wild-type HVS, which immortalized CD4- CD8+ single-positive T lymphocytes . HVS deltaSTP/v-Ras-immortalized T cells showed high Ras expression and an adherent macrophage-like morphology, likely due to the activation of AP-1 transcriptional factor activity .

  • Tumor Induction Both HVS deltaSTP/v-Ras and HVS deltaSTP/c-Ras induced lymphoma in common marmosets, with the v-Ras virus leading to a more rapid onset of the disease .

Comparison with Other Viral Proteins

  • K1 of KSHV Kaposi's sarcoma-associated herpesvirus (KSHV) contains an open reading frame called K1 at a position equivalent to the STP gene in HVS . Although KSHV and HVS are related, K1 and STP do not share amino acid sequence similarity or structural organization . K1 expression in rodent fibroblasts induces morphologic changes and focus formation, indicative of transformation. A recombinant herpesvirus in which the STP oncogene of HVS was replaced with K1 immortalized primary T lymphocytes to IL-2 independent growth and induced lymphoma in common marmosets, demonstrating the transforming potential of the K1 gene of KSHV .

  • Tio of Herpesvirus Ateles Herpesvirus ateles has a gene called tio located at a genomic position equivalent to the HVS oncogenes. The tio gene product, Tio, shares sequence homologies with both StpC and Tip . Studies using recombinant viruses show that Tio can replace StpC and Tip in transforming monkey and human T cells .

Impact on T-Cell Growth

  • Growth Transformation Herpesvirus saimiri C488 can induce growth transformation of human T cells without needing further stimulation by an antigen .

  • IL-2 Independence Recombinant viruses expressing Tio can reduce the requirement for exogenous IL-2, typically seen with wild-type HVS C488-transformed cells, resulting in high transformation efficiency even without exogenous IL-2 .

Recombinant Saimiriine Herpesvirus 2 Transforming Protein STP(1) Properties

PropertyDescription
Size50 ug (other sizes available upon inquiry)
Product TypeRecombinant Protein
SpeciesSaimiriine herpesvirus 2 (strain 11) (SaHV-2) (Herpesvirus saimiri)
Uniprot NO.P18347
Tag InfoDetermined during production process
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
StorageStore at -20℃; for extended storage, conserve at -20℃ or -80℃. Avoid repeated freezing and thawing .
AA SequenceMARGLGEGDPQENDESNGDPPHNTDERSDGDDGPTPYLPVTLLNAGPFGPYNPYCLLGHPVQESGCPGRPTALSGAVGLPTPSGSRSSSHLSTPVGLSAVRVSGCGGAGSEEHVYAEVGS LHSEHEQEGDKCTDCSVTILLLLVIIVLLLIIIGLMLVIMFKKM
Protein NamesTransforming protein STP
Gene NamesSTP
Expression Region1-164
Sequence InfoFull length protein

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance (additional fees apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
1; STP; Transforming protein STP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Saimiriine herpesvirus 2 (strain 11) (SaHV-2) (Herpesvirus saimiri)
Target Names
1
Target Protein Sequence
MARGLGEGDPQENDESNGDPPHNTDERSDGDDGPTPYLPVTLLNAGPFGPYNPYCLLGHP VQESGCPGRPTALSGAVGLPTPSGSRSSSHLSTPVGLSAVRVSGCGGAGSEEHVYAEVGS LHSEHEQEGDKCTDCSVTILLLLVIIVLLLIIIGLMLVIMFKKM
Uniprot No.

Target Background

Function
STP is necessary for viral transformation but not for replication. T-lymphocytes are the target cells for transformation by herpesvirus saimiri.
Gene References Into Functions
  1. STP-A11 activates the non-canonical NF-κB pathway, leading to p100 processing to p52. PMID: 17028057
Database Links

KEGG: vg:1488260

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Saimiriine herpesvirus 2 Transforming protein STP?

STP (Saimiri Transformation-associated Protein) is a viral protein encoded by Herpesvirus saimiri that is not required for viral replication but is essential for in vitro immortalization of T lymphocytes and for the lymphoma-inducing capacity of the virus . It functions as a viral oncogene capable of transforming T cells through interaction with cellular signaling pathways. The protein has different variants corresponding to different viral subgroups (A, B, and C), with distinct molecular mechanisms of action but similar transforming capabilities . These variants differ in sequence but retain critical functional domains that mediate interactions with host cell proteins involved in signal transduction.

How do the different STP variants from subgroups A, B, and C compare structurally?

STP variants from different viral subgroups show considerable sequence divergence while maintaining key functional domains. Sequence analysis of subgroup A STP variants reveals:

  • A highly conserved acidic amino terminus

  • Extensive amino acid substitutions within the central region

  • A well-conserved hydrophobic carboxyl terminus

  • Amino acid identities varying from 73% to 99% among different subgroup A isolates

The subgroup C STP (STP-C488) differs significantly from subgroup A STPs and is co-expressed with another protein called Tip (tyrosine kinase-interacting protein) from a bicistronic mRNA . Both proteins are essential for the transforming capabilities of subgroup C viruses. While the specific structural details vary, all STP variants maintain the ability to interact with cellular signaling pathways critical for cell transformation.

What is the relationship between STP and viral pathogenesis?

STP plays a central role in the pathogenic properties of Herpesvirus saimiri. Experimental evidence clearly demonstrates this relationship:

  • Deletion mutants lacking STP fail to transform T lymphocytes in vitro and do not induce lymphomas in susceptible primates

  • Wild-type HVS produces fatal lymphoma within 19-20 days in common marmosets, while STP deletion mutants are non-oncogenic

  • STP is dispensable for viral replication and persistence, as virus can be repeatedly isolated from peripheral blood of marmosets infected with STP-deletion mutants

The transforming and pathogenic capabilities of Herpesvirus saimiri are directly linked to the presence of functional STP, making it a key determinant of the virus's oncogenic potential. Different viral subgroups (A, B, and C) have been established based on the pathogenic phenotypes and sequence variations in this region of the viral genome .

How does STP-A interact with cellular signaling pathways?

STP-A interacts with cellular signaling pathways primarily through its association with src family kinases. Key aspects of this interaction include:

  • The highly conserved YAEV/I motif at amino acid residues 115-118 is preceded by negatively charged glutamic acid residues, closely matching the consensus sequence for binding to SH2 domains of src family kinases

  • STP-A has been demonstrated to associate with cellular src and serves as an in vitro substrate for src kinase

  • Mutational analysis of STP-A11 shows that binding to src kinase requires the tyrosine residue at position 115, confirming that YAEV/I is a likely binding motif for src

  • Following tyrosine phosphorylation of STP-A11 by src, the protein can subsequently bind to other src family kinases including lck and fyn in vitro

These interactions suggest a model where STP-A recruitment of src family kinases leads to dysregulation of normal T-cell signaling, contributing to uncontrolled cellular proliferation and ultimately transformation.

What are the key functional domains in STP-C488 and how do they contribute to T-cell transformation?

STP-C488 from subgroup C viruses contains several functional domains that contribute to its transforming capacity:

  • STP-C fulfills typical criteria of an oncogene

  • It interacts with Ras and tumor necrosis factor-associated factors

  • STP-C induces mitogen-activated protein kinase activation

  • It activates nuclear factor kappa B signaling

In subgroup C viruses, STP-C and Tip are transcribed from a single bicistronic mRNA, and both proteins are essential for transformation and leukemia induction . While STP-C mediates interactions with Ras and TNF-associated factors, its partner protein Tip interacts with:

  • RNA transport factor Tap

  • Signal transduction and activation of transcription factors

  • T-cellular tyrosine kinase Lck, which is activated by this interaction and phosphorylates Tip as a substrate

Together, these interactions create a network of dysregulated signaling that drives T-cell transformation.

What experimental evidence demonstrates the requirement for STP in cellular transformation?

Multiple lines of experimental evidence confirm the essential role of STP in cellular transformation:

  • Mutant forms of HVS with deletions in STP-C488 fail to immortalize common marmoset T lymphocytes to interleukin-2-independent growth in vitro

  • Wild-type HVS produces fatal lymphoma within 19-20 days following experimental infection of common marmosets, while STP deletion mutants are non-oncogenic

  • Both STP and Tip are required for transformation, as deletion of either protein abolishes transforming capability

  • Despite lacking transforming ability, STP deletion mutants maintain the ability to replicate and persist, as virus can be repeatedly isolated from the peripheral blood of marmosets infected with mutant virus for more than 5 months

These findings conclusively demonstrate that while STP is dispensable for viral replication and persistence, it is absolutely essential for the transforming phenotype both in vitro and in vivo.

What approaches are used to express and purify recombinant STP for functional studies?

Researchers typically use the following methods to express and purify recombinant STP:

  • Cloning and sequencing: STP genes from various subgroup isolates are cloned into appropriate expression vectors. For example, STP genes from six subgroup A isolates were cloned and sequenced to assess sequence variation effects on function .

  • Expression systems: Common expression systems include:

    • Bacterial expression (E. coli) for structural studies

    • Mammalian expression systems (HEK293T, COS cells) for functional studies

    • Baculovirus expression for higher protein yields with eukaryotic processing

  • Purification strategies:

    • Affinity chromatography using epitope tags (His, GST, FLAG)

    • Ion exchange chromatography

    • Size exclusion chromatography for final purification

  • Functional verification: Activity of purified protein is typically assessed through:

    • In vitro kinase assays with src family kinases

    • Binding assays with potential cellular partners

    • Structural analysis using circular dichroism or other methods

When designing expression constructs, it's important to consider the conserved domains identified through sequence analysis, as the acidic amino terminus and hydrophobic carboxyl terminus are well conserved and likely critical for function .

What methods are used to investigate the interaction between STP and cellular proteins?

Several complementary approaches are employed to study STP interactions with cellular proteins:

  • Co-immunoprecipitation assays: Used to demonstrate physical association between STP and cellular kinases such as src, lck, and fyn .

  • In vitro kinase assays: Used to show that STP serves as a substrate for src kinase and becomes phosphorylated at specific tyrosine residues .

  • Mutational analysis: Site-directed mutagenesis of key residues (such as tyrosine 115 in STP-A11) to identify specific amino acids required for protein-protein interactions .

  • Yeast two-hybrid screening: To identify novel cellular binding partners.

  • Mass spectrometry-based approaches: Including immunoprecipitation followed by mass spectrometry to identify protein complexes formed with STP in cells.

  • Immunofluorescence microscopy: To examine co-localization of STP with cellular proteins in intact cells.

These approaches have revealed that STP-A associates with src family kinases through a conserved YAEV/I motif at amino acid residues 115-118, and this interaction is critical for its transforming function .

How can researchers generate and characterize STP deletion or point mutants?

Researchers use the following methodological approaches to generate and characterize STP mutants:

  • Generation of mutants:

    • Site-directed mutagenesis for introducing specific point mutations (particularly in conserved motifs)

    • PCR-based techniques for generating deletion constructs

    • Recombineering or BAC mutagenesis for introducing mutations into the full viral genome

  • Mutant characterization:

    • Binding assays with purified proteins to assess interaction with cellular partners

    • Transformation assays in cultured cells to determine effects on transforming capacity

    • In vivo pathogenesis studies in animal models like common marmosets

    • Biochemical analysis of signaling pathway activation

  • Functional verification:

    • Comparison of wild-type virus with mutant versions for ability to transform T cells

    • Assessment of protein-protein interactions through co-immunoprecipitation

    • Analysis of downstream signaling effects

Studies using this approach have demonstrated that tyrosine 115 in STP-A11 is critical for binding to src kinase, confirming the YAEV/I motif as a likely binding site for src . Similarly, deletion mutants lacking either STP or Tip failed to transform T cells in vitro or cause lymphomas in vivo, establishing their essential role in oncogenesis .

How is STP used to generate stable T-cell lines for immunological research?

STP-expressing Herpesvirus saimiri provides valuable tools for T-cell immunology research:

  • Generation of stable T-cell lines:

    • Certain subgroup C virus strains like C488 can transform human T lymphocytes to stable growth in culture

    • The transformed human T cells maintain multiple copies of the viral genome as stable, non-integrated episomes

    • These cells express only a few viral genes and do not produce virus particles

  • Preserved T-cell functionality:

    • Transformed T cells maintain the antigen specificity of their parental T-cell clones

    • They preserve many other essential functions of the original T cells

    • They retain major histocompatibility complex-restricted antigen-specific reactivity

  • Research applications:

    • Long-term culture of antigen-specific T cells

    • Gene transfer studies

    • Potentially for experimental adoptive immunotherapy

This system offers significant advantages over standard methods for T-cell culture by allowing the establishment of stable, functional T-cell lines that maintain their specialized properties.

What genetic alterations occur in T cells following transformation with STP-expressing virus?

T cells transformed by Herpesvirus saimiri show relatively limited genetic alterations:

  • Viral genome persistence:

    • Multiple copies of the viral genome are maintained as stable, non-integrated episomes

    • Only a few viral genes are expressed in transformed cells

  • Cellular gene expression changes:

    • Despite retaining many normal T-cell functions, some changes in gene expression occur

    • A novel cellular gene, ak155, a sequence homolog of interleukin-10, is specifically overexpressed in HVS-transformed T cells

    • AK155 is secreted into the supernatant and forms homodimers similarly to interleukin-10

    • This lymphokine may contribute to the transformed phenotype

  • Cell signaling alterations:

    • STP and Tip interact with cellular signaling proteins

    • STP-C interacts with Ras and TNF-associated factors

    • Tip interacts with Lck and other signaling molecules

These findings indicate that HVS transformation induces specific changes in cellular gene expression while preserving many aspects of normal T-cell function and phenotype.

How do the transforming mechanisms of STP differ from other viral oncoproteins?

STP's transforming mechanisms show both similarities and differences compared to other viral oncoproteins:

  • Unique aspects of STP transformation:

    • STP-C and Tip function as a bicistronic unit in subgroup C viruses

    • Different STP variants (A, B, C) use distinct molecular mechanisms

    • STP-transformed cells maintain antigen specificity and many normal T-cell functions

  • Comparison with other viral oncoproteins:

    • Like many viral oncoproteins, STP targets conserved signaling pathways (MAPK, NF-κB)

    • Unlike some viral oncoproteins that target tumor suppressors (e.g., HPV E6/E7), STP primarily activates signaling pathways

    • Subgroup A STPs interact with src family kinases , resembling mechanisms used by other viral oncoproteins

  • Functional consequences:

    • STP transforms specifically T lymphocytes, unlike some broader-acting viral oncoproteins

    • The transformation preserves many cell functions, suggesting a more subtle mechanism

    • Transformed cells show specific gene expression changes, such as induction of the IL-10 homolog AK155

Understanding these unique aspects of STP-mediated transformation provides insights into both viral pathogenesis and fundamental aspects of cellular signaling that contribute to transformation.

What is the relationship between STP and the viral homologs of cellular genes in Herpesvirus saimiri?

Herpesvirus saimiri contains multiple viral homologs of cellular genes, although their relationship with STP function presents intriguing research questions:

  • Cellular homologs in HVS genome:

    • The genome harbors several virus genes with homology to cellular counterparts including a D-type cyclin, a G-protein-coupled receptor, an interleukin-17, a superantigen homologue, and inhibitors of complement cascade and apoptosis pathways

    • Most of these cellular homologs have preserved functions

  • Relationship to transformation:

    • Most viral homologs of cellular genes are dispensable for transforming and pathogenic capability

    • They are considered relevant primarily for apathogenic persistence in the natural host

    • In contrast, STP is essential for transformation and pathogenesis

  • Research implications:

    • The viral homologs may complement STP function during natural infection

    • They may create an optimal cellular environment for STP-mediated transformation

    • Study of these relationships could reveal novel aspects of viral persistence and pathogenesis

This complex relationship between viral homologs of cellular genes and the transforming proteins provides a rich area for further investigation into viral evolution and oncogenic mechanisms.

How might structural analysis of STP inform the development of inhibitors?

Structural analysis of STP could guide inhibitor development through several approaches:

  • Key structural features for targeting:

    • The conserved YAEV/I motif (residues 115-118) critical for src kinase binding in STP-A

    • The acidic amino terminus and hydrophobic carboxyl terminus that are highly conserved across variants

    • Interfaces mediating interaction with Ras and TNF-associated factors in STP-C

  • Potential inhibitor strategies:

    • Small molecules targeting the STP-src interaction interface

    • Peptide-based inhibitors mimicking key binding regions

    • Allosteric inhibitors that alter protein conformation

  • Structure-guided approaches:

    • Determination of high-resolution structures by X-ray crystallography or cryo-EM

    • Molecular dynamics simulations to identify druggable pockets

    • Fragment-based drug discovery targeting key functional domains

  • Therapeutic implications:

    • Inhibitors could serve as research tools to further elucidate transformation mechanisms

    • They might provide insights for targeting similar pathways in human cancers

    • The specificity of STP interactions could allow selective targeting with minimal off-target effects

While primarily valuable for basic research, such studies might eventually inform approaches to targeting similar oncogenic mechanisms in human diseases.

What are the implications of STP research for understanding human gamma-herpesvirus pathogenesis?

Research on STP provides valuable insights for understanding human gamma-herpesvirus pathogenesis:

  • Relevance to human herpesviruses:

    • Herpesvirus saimiri is related to human Kaposi's sarcoma-associated herpesvirus (KSHV/HHV-8), another gamma-2 herpesvirus

    • Understanding STP mechanisms may shed light on similar processes in KSHV oncogenesis

  • Comparative insights:

    • Both HVS and KSHV encode proteins that manipulate cellular signaling pathways

    • The study of STP's interaction with src kinases, Ras, and TNF-associated factors provides models for understanding similar interactions in human viruses

    • Mechanisms of viral persistence in the absence of disease in natural hosts may have parallels with human virus infections

  • Experimental advantages:

    • HVS provides a tractable experimental system for studying gamma-herpesvirus pathogenesis

    • The ability to generate STP mutants and test their effects in vitro and in vivo allows mechanistic studies difficult to perform with human viruses

    • T-cell transformation by HVS provides models for understanding virus-induced lymphoproliferative disorders

The knowledge gained from studying STP contributes to our broader understanding of viral oncogenesis and may inform new approaches to preventing or treating diseases caused by related human viruses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.