Recombinant Salaria pavo Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salaria pavo Rhodopsin (rho)

Recombinant Salaria pavo Rhodopsin (rho) is a genetically engineered form of the visual pigment protein derived from the Peacock blenny (Salaria pavo), a marine fish species. Rhodopsin, a G-protein-coupled receptor (GPCR), is critical for phototransduction in rod photoreceptor cells, enabling dim-light vision . The recombinant variant allows researchers to study its structural and functional properties without isolating the protein directly from native tissues.

Sequence and Domains

The full-length recombinant protein consists of 354 amino acids (UniProt ID: Q9YGZ3) . Key structural features include:

  • Seven transmembrane (7TM) helices: Characteristic of GPCRs, facilitating light signal transduction.

  • N-terminal cap: Stabilizes the protein during biosynthesis and contributes to dark-state stability .

  • Retinal-binding lysine residue (K296): Forms a protonated Schiff base with 11-cis-retinal, essential for light absorption .

Table 1: Sequence Features of Recombinant Salaria pavo Rhodopsin

FeatureDetails
Gene Namerho
OrganismSalaria pavo (Peacock blenny)
Expression RegionAmino acids 1–354 (full-length)
Post-Translational ModificationsGlycosylation sites at N-terminal residues (e.g., T4, T17) .

Biophysical Properties

  • Absorption spectrum: Peak sensitivity in the blue-green range (~500 nm), typical of aquatic rhodopsins .

  • Thermal stability: Dependent on proper folding and retinal binding; mutations destabilize the protein .

Expression and Production

Recombinant Salaria pavo Rhodopsin is produced in heterologous expression systems (e.g., HEK293T or photoreceptor cell lines) to ensure high yields and purity .

Mechanistic Studies of Retinal Diseases

  • Disease modeling: Mutations in rhodopsin cause retinitis pigmentosa (RP) and congenital stationary night blindness (CSNB) . Recombinant Salaria pavo Rhodopsin enables comparative studies of pathogenic mutations (e.g., P23H, R135L) .

  • Pharmacological rescue: Testing retinal analogs or chaperones (e.g., 9-cis-retinal) to restore folding in misfolded mutants .

Key Research Findings

  • Energy metabolism dysfunction: Overexpression of wild-type or mutant rhodopsin disrupts oxidative phosphorylation and glycolysis in photoreceptor cells, accelerating degeneration .

  • Localization patterns: Sector RP-associated mutants (e.g., L31Q) traffic primarily to rod outer segments in transgenic models, with degeneration mitigated by dark rearing or blocking chromophore binding .

Future Directions

  • Gene therapy: RNA replacement strategies (e.g., siRNA-resistant RHO mRNA) to suppress mutant rhodopsin expression while restoring wild-type function .

  • High-throughput screening: Identifying small-molecule correctors for pathogenic variants using deep mutational scanning (DMS) .

Product Specs

Form
Supplied as a lyophilized powder.
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill your request if possible.
Lead Time
Delivery times vary depending on the order method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request, but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your requirements.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Salaria pavo (Peacock blenny) (Lipophrys pavo)
Target Names
rho
Target Protein Sequence
MNGTEGPYFYIPMVNTTGIVRSPYEYPQYYLVNPAAYAALGAYMFFLILLGFPINFLTLY VTLEHKKLRTPLNYILLNLAVADLFMVFGGFTTTMYTSMHGYFVLGRLGCNLEGFFATLG GEIGLWSLVVLAIERWVVVCKPISNFRFGENHAIMGLAFTWIMACACAVPPLVGWSRYIP EGMQCSCGVDYYTRAEGFNNESFVVYMFTCHFCIPLTIIGFCYGRLLCAVKEAAAAQQES ETTQRAEREVTRMVILMVVGFLVCWLPYASVAWYIFSNQGSQFGPLFMTIPAFFAKSSSV YNPMIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTASKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function

Recombinant Salaria pavo Rhodopsin (rho) Background: A photoreceptor crucial for low-light vision. While most saltwater fish utilize retinal as a chromophore, freshwater species often employ 3-dehydroretinal, or a mixture of both. Light-induced isomerization of 11-cis to all-trans retinal initiates a conformational change, activating G-protein signaling. Subsequent receptor phosphorylation, mediated by arrestin, displaces the bound G-protein alpha subunit, terminating the signaling cascade.

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.