Recombinant Salinibacter ruber ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; SRU_0913; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Salinibacter ruber (strain DSM 13855 / M31)
Target Names
atpF
Target Protein Sequence
MTALFAQSLVTPSVGLIFWKTVAFLIFLYILYRFGWGPITESLEEREEEIEHSIQRAEEA LEEAKAIQAENEEARREAEQKAQQILREARDSAEELREEEKAKTRREIQEMKEQAQAEIE REKQAALQELRDEVADLAIEAAQKIIENDLDADRHRQLVDDALDDFPTN
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Salinibacter ruber and why is its ATP synthase of interest?

Salinibacter ruber is an extremely halophilic bacterium found in hypersaline environments, particularly in saltern crystallizers containing approximately 37% NaCl. Despite being a bacterium (belonging to the phylum Rhodothermaeota), it displays remarkable similarities to halophilic Archaea (Haloarchaea) . The ATP synthase of S. ruber is of particular interest because it functions in an environment with extraordinarily high salt concentrations, making it a valuable model for studying bioenergetic adaptations to extreme conditions.

The atpF gene encodes the b subunit of ATP synthase, which forms part of the F₀ sector of F-type ATPase . ATP synthase is crucial for cellular energy production, utilizing proton gradients across membranes to generate ATP. Understanding how this protein functions in hypersaline conditions provides insights into extremophile biology and potentially novel bioenergetic mechanisms.

How does S. ruber adapt to extremely high salt environments?

S. ruber employs the "salt-in" strategy for adaptation to hypersaline environments, which is typically observed in haloarchaea rather than bacteria . This adaptation mechanism involves:

  • Intracellular accumulation of mineral ions, primarily K⁺ and Cl⁻

  • Extensive genome-wide adjustments to prepare enzymatic systems for hypersaline cytoplasmic conditions

  • Modification of the proteome with distinctive characteristics including:

    • Higher content of acidic amino acids (aspartic acid, glutamic acid)

    • Lower content of hydrophobic residues

    • Altered isoelectric points of bulk proteins

These adaptations are primarily achieved through convergent evolution rather than lateral gene transfer, making S. ruber an excellent model for studying evolutionary adaptation processes .

What are the optimal conditions for expressing recombinant S. ruber ATP synthase subunit b?

Based on the protein's characteristics and halophilic nature, the following protocol is recommended:

  • Expression system: Use a salt-tolerant expression system such as modified E. coli strains designed for expressing halophilic proteins.

  • Expression vector: Select vectors with appropriate promoters (e.g., T7 or similar strong promoters) that can be modulated to prevent toxicity.

  • Growth conditions:

    • Culture medium: LB medium supplemented with 0.5-2M NaCl

    • Temperature: 25-30°C (lower temperatures often yield better results for halophilic proteins)

    • Induction: Use IPTG at 0.1-0.5 mM for gradual expression

  • Post-induction: Harvest cells 4-6 hours after induction at moderate temperatures, or overnight at lower temperatures (16-18°C)

The recombinant protein may require a salt-containing buffer during purification to maintain stability and proper folding .

How should recombinant S. ruber ATP synthase subunit b be stored for optimal stability?

According to product specifications, the optimal storage conditions are :

  • Storage buffer: Tris-based buffer with 50% glycerol, specifically optimized for this protein

  • Short-term storage: Store working aliquots at 4°C for up to one week

  • Long-term storage: Store at -20°C; for extended storage, conserve at -20°C or -80°C

  • Important note: Repeated freezing and thawing is not recommended as it may compromise protein stability and activity

These storage conditions are designed to preserve the structural integrity and functional properties of the protein while preventing denaturation commonly associated with halophilic proteins when removed from their high-salt environment.

What experimental design approaches are most effective for studying ATP synthase function?

An effective experimental design for studying ATP synthase function should follow these key steps :

  • Define your variables clearly:

    • Independent variable: Typically salt concentration, pH, temperature, or specific inhibitors

    • Dependent variable: ATP synthesis activity, proton pumping efficiency, or complex assembly

  • Formulate a specific, testable hypothesis about how environmental conditions affect ATP synthase function

  • Design experimental treatments that systematically manipulate your independent variable:

    • For salt concentration studies: Test a range from 0.5M to 5M NaCl

    • For pH studies: Test range from pH 6.0 to pH 9.0

    • For temperature studies: Test range from 20°C to 50°C

  • Assign proper experimental controls:

    • Positive control: Known functional ATP synthase under optimal conditions

    • Negative control: Denatured enzyme or specific ATP synthase inhibitor

    • Vehicle control: Buffer components without the variable of interest

  • Plan precise measurement methods for your dependent variable:

    • Spectrophotometric ATP synthesis assays

    • Membrane potential measurements

    • Blue native PAGE for complex assembly analysis

How does the structure and function of S. ruber ATP synthase subunit b compare to those from non-halophilic organisms?

The S. ruber ATP synthase subunit b shows several distinctive adaptations compared to non-halophilic counterparts:

  • Amino acid composition: Higher proportion of acidic residues (particularly aspartic acid and glutamic acid) and lower content of hydrophobic residues compared to mesophilic equivalents

  • Structural adaptations: The protein likely maintains a more rigid structure in high salt conditions, with salt bridges playing a critical role in stability, similar to other halophilic proteins

  • Functional differences: While the core mechanism of ATP synthesis remains conserved, S. ruber ATP synthase likely exhibits:

    • Optimal activity at higher salt concentrations (3-4M NaCl)

    • Different pH optima (typically more alkaline)

    • Altered interactions with other ATP synthase subunits

  • Evolutionary aspects: Comparative analysis suggests that these adaptations arose through convergent evolution rather than lateral gene transfer, providing a unique example of molecular adaptation to extreme environments

These differences highlight how S. ruber has adapted its energy production machinery to function in extreme environments while maintaining the fundamental mechanism of ATP synthesis.

What is known about the interaction between ATP synthase subunit b and other components of the ATP synthase complex in S. ruber?

In S. ruber, the ATP synthase complex follows the typical F-type ATPase structure but with halophilic adaptations. The interaction between subunit b and other components likely follows patterns similar to those observed in other organisms with specific modifications:

Notably, studies on the FUS protein (in an unrelated context) have shown that interactions with ATP synthase β-subunit (ATP5B) can disrupt ATP synthase complex assembly and suppress activity . This suggests that proper interaction between subunits is crucial for functional assembly across different organisms.

What molecular adaptations allow S. ruber ATP synthase to function in extreme salt concentrations?

S. ruber ATP synthase functions in environments with salt concentrations approaching saturation through several specialized adaptations:

  • Protein surface characteristics:

    • Enrichment of acidic residues on protein surfaces creates a hydration shell that maintains protein solubility

    • Reduction in surface-exposed hydrophobic residues prevents salting-out effects

    • Strategic placement of charged residues creates stabilizing salt bridges

  • Ion binding and coordination:

    • Specific binding sites for K⁺ ions that stabilize protein structure

    • Altered metal coordination properties to maintain function in high ionic strength

  • Proton pumping modifications:

    • Adapted proton channels to function despite altered membrane properties in high salt

    • Modified coupling between proton translocation and ATP synthesis

  • Membrane adaptations:

    • Specialized lipid interactions to maintain membrane integration

    • Modified membrane domain structure to ensure stability in hypersaline conditions

These adaptations collectively allow S. ruber ATP synthase to maintain functional energy production in environments that would be prohibitive for most organisms .

How does ATP synthase function integrate with the broader metabolism of S. ruber?

ATP synthase functions as a central component in S. ruber's energy metabolism, interconnected with several metabolic pathways:

  • Respiratory chain: S. ruber possesses a complete tricarboxylic acid (TCA) cycle and a cytochrome c-containing respiratory chain. Notably, it contains two clusters of cytochrome c oxidase subunits I and II genes - one cluster (coxA1, coxB1) related to Rhodothermus marinus, and another (coxA2, coxB2) showing close relation to haloarchaeal homologs . This dual system likely represents an adaptation to microoxic conditions often found in hypersaline environments.

  • Carbon metabolism: Research indicates that S. ruber primarily utilizes the pentose phosphate pathway rather than the Embden-Meyerhof glycolytic pathway for glucose consumption . This is supported by flux balance analysis showing zero or unfeasibly low production of pyruvate from glucose via glycolysis, with glucose being consumed through the pentose phosphate pathway instead.

  • Potential autotrophic capabilities: S. ruber possesses enzymes of the reductive tricarboxylic acid cycle (rTCA), although whether this represents true autotrophic capacity remains uncertain. The table below shows the key rTCA reactions and their associated genes in S. ruber :

Kegg IDEnzyme recommended name (EC)Gene in S. ruberReaction detailsNotes
R00342malate dehydrogenase (1.1.1.37)SRU_1571Oxaloacetate + NADH + H⁺ ↔ NAD⁺ + L-Malate
R01082fumarate hydratase (4.2.1.2)SRU_1611L-Malate ↔ H₂O + Fumarate
R02164succinate dehydrogenase / fumarate reductase (1.3.5.1, 1.3.5.4)SRU_0485 SRU_2444 SRU_0484Fumarate + QH₂ ↔ Succinate + Q
R00405succinate-CoA ligase ADP-forming (6.2.1.5)SRU_0670 SRU_1125ATP + CoA + Succinate ↔ ADP + Phosphate + Succinyl-CoA
R011972-oxoglutarate synthase (1.2.7.3)SRU_0424CO₂ + H⁺ + Succinyl-CoA + 2 Reduced ferredoxin ↔ CoA + 2-Oxoglutarate + 2 Oxidized ferredoxinKey Enzyme

These metabolic pathways collectively support ATP synthase function by generating the proton gradient necessary for ATP synthesis, while the ATP produced powers various cellular processes .

How has genome-scale metabolic modeling contributed to our understanding of S. ruber bioenergetics?

Genome-scale metabolic modeling has provided significant insights into S. ruber bioenergetics:

These modeling approaches continue to refine our understanding of how S. ruber's energy metabolism, including ATP synthase function, is adapted to hypersaline conditions.

What does S. ruber ATP synthase reveal about convergent evolution and lateral gene transfer?

S. ruber ATP synthase provides a fascinating case study in evolutionary adaptation through both convergent evolution and lateral gene transfer:

  • Convergent evolution: Despite being a bacterium, S. ruber has independently evolved protein characteristics similar to those found in haloarchaea. This includes :

    • Higher content of acidic amino acids in the proteome

    • Similar isoelectric point characteristics for bulk proteins

    • Salt-dependent enzymatic activities

  • Lateral gene transfer (LGT): While many halophilic adaptations arose through convergent evolution, genomic analysis reveals that some genes and gene clusters were acquired through LGT from haloarchaea. Examples include :

    • Several rhodopsin genes, including three of the haloarchaeal type (previously uncharacterized in bacterial genomes)

    • The second cytochrome c oxidase gene cluster (coxA2, coxB2)

    • Various other genes involved in adaptation to hypersaline environments

  • Evolutionary implications: The case of S. ruber demonstrates that adaptation to extreme environments can occur through multiple evolutionary mechanisms operating simultaneously. This suggests that the extreme selection pressures of hypersaline environments drive both convergent evolution and facilitate lateral gene transfer between phylogenetically distant organisms sharing the same extreme niche .

The ATP synthase of S. ruber represents an excellent model for studying how critical energy-generating machinery can be adapted to extreme conditions through these evolutionary processes.

How does S. ruber ATP synthase compare with those from other extremophiles?

Comparative analysis of S. ruber ATP synthase with those from other extremophiles reveals distinct adaptation strategies:

  • Comparison with other halophiles:

    • Unlike haloarchaea, which evolved in hypersaline environments over billions of years, S. ruber represents a more recent adaptation to these conditions

    • Proteomic data reveals important differences between the amino acid compositions of proteins from Halanaerobiales, Halobacteria, Methanomicrobia, and Nanohaloarchaea, despite sharing similar environments

    • Several taxa from Bacteroidetes, Rhodothermaeota, and Proteobacteria show amino acid profiles similar to the extremely halophilic Halobacteria, suggesting either horizontal gene transfer or convergent evolution

  • Comparison with thermophiles:

    • Thermophiles like Rhodothermus marinus (the closest relative to S. ruber with 89% 16S rRNA sequence similarity) adapt their ATP synthases to high temperatures through increased hydrophobic interactions and disulfide bridges

    • In contrast, S. ruber's adaptation involves increased surface negative charge and reduced hydrophobic exposure

    • Both adaptations aim to maintain protein stability but through different molecular mechanisms

  • Functional adaptations:

    • Acidophile ATP synthases typically have structural modifications to prevent proton leakage at low pH

    • Alkaliphile ATP synthases have adapted to function with low proton motive force

    • S. ruber ATP synthase has adapted to function with high ionic strength and potentially altered membrane properties

These comparisons demonstrate how ATP synthase, a highly conserved enzyme complex essential for cellular energetics, can be modified through evolution to function in diverse extreme environments .

What are the common challenges in expressing and purifying recombinant S. ruber ATP synthase subunit b?

Researchers face several challenges when working with recombinant S. ruber ATP synthase subunit b:

  • Expression challenges:

    • Toxicity in standard expression hosts due to the acidic nature of the protein

    • Improper folding in non-halophilic expression systems

    • Formation of inclusion bodies when expressed at high levels

    • Codon usage bias affecting translation efficiency

  • Purification difficulties:

    • Requirement for high salt concentrations during purification

    • Potential loss of activity when salt concentration is reduced

    • Co-purification of host proteins that interact with the highly charged recombinant protein

    • Aggregation during concentration steps

  • Activity assessment:

    • Difficulties in reconstituting functional ATP synthase complexes

    • Challenges in establishing appropriate in vitro assay conditions

    • Need for specialized high-salt buffers for activity measurements

To address these challenges, researchers can employ strategies such as using salt-tolerant expression hosts, optimizing codon usage, employing halophilic protein tags, and maintaining appropriate salt concentrations throughout the purification process .

How can researchers optimize experimental design for studying S. ruber ATP synthase in vitro?

Optimizing experimental design for studying S. ruber ATP synthase requires careful consideration of its halophilic nature:

  • Buffer optimization:

    • Use buffers containing 2-4M KCl or NaCl to maintain protein stability

    • Include glycerol (5-20%) to prevent aggregation during freeze-thaw cycles

    • Maintain pH in the range of 7.5-8.5 where activity is likely optimal

    • Consider adding stabilizing agents such as betaine or ectoine

  • Reconstitution strategies:

    • Use liposomes composed of archaeal-like lipids or synthetic lipids resistant to high salt

    • Employ gradual dialysis methods to reconstitute the protein into membranes

    • Consider nanodiscs as an alternative membrane mimetic system

  • Activity assays:

    • Adapt standard ATP synthase assays to high-salt conditions

    • Use salt-resistant coupling enzymes for linked enzyme assays

    • Employ direct methods such as luminescence-based ATP detection

    • Consider fluorescence-based proton gradient measurements

  • Controls and variables :

    • Include proper controls for spontaneous ATP hydrolysis in high salt

    • Test multiple salt concentrations to establish the activity profile

    • Use inhibitors specific to F-type ATP synthases as negative controls

    • Compare with mesophilic ATP synthases under standard conditions as reference points

  • Data analysis:

    • Account for the effects of high salt on spectroscopic measurements

    • Use appropriate statistical methods to analyze variability in high-salt conditions

    • Consider kinetic modeling approaches to understand salt effects on enzyme parameters

These optimizations will help ensure reliable and reproducible results when studying this extremophilic enzyme in vitro .

What are promising areas for future research on S. ruber ATP synthase subunit b?

Several promising research directions could advance our understanding of S. ruber ATP synthase:

  • Structural studies:

    • High-resolution structural determination of S. ruber ATP synthase through cryo-electron microscopy

    • Comparative structural analysis with mesophilic and haloarchaeal ATP synthases

    • Investigation of salt-dependent structural changes using small-angle X-ray scattering

  • Functional characterization:

    • Single-molecule studies of rotary mechanics under varying salt concentrations

    • Investigation of proton translocation efficiency in hypersaline conditions

    • Characterization of ATP synthesis rates at different salt concentrations and pH values

  • Evolutionary studies:

    • Ancestral sequence reconstruction to trace the evolutionary pathway of halophilic adaptation

    • Comparative genomics across the Rhodothermaeota phylum to identify conserved adaptations

    • Experimental evolution studies to observe real-time adaptation of ATP synthase to changing salt conditions

  • Biotechnological applications:

    • Engineering salt-tolerant ATP synthases for bioenergy applications

    • Development of stabilized ATP synthases using principles from S. ruber

    • Creation of hybrid ATP synthases with enhanced stability in industrial conditions

These research directions would significantly advance our understanding of extremophilic bioenergetics and potentially lead to novel biotechnological applications .

How might understanding S. ruber ATP synthase contribute to synthetic biology applications?

Understanding the adaptations of S. ruber ATP synthase offers several potential applications in synthetic biology:

  • Designer ATP synthases:

    • Creation of chimeric ATP synthases with enhanced stability in non-physiological conditions

    • Development of ATP synthases that function in organic solvents or other industrial environments

    • Engineering of ATP synthases with modified ion specificities (e.g., Na⁺ instead of H⁺)

  • Minimal cell design:

    • Incorporation of salt-stable bioenergetic modules into minimal cell designs

    • Development of cellular systems that can function in extreme environments

    • Creation of orthogonal energy production systems for synthetic cells

  • Bioenergy applications:

    • Design of salt-tolerant biological systems for ATP production from gradient-generating processes

    • Development of stable ATP synthases for long-term energy storage solutions

    • Creation of robust biological fuel cells that can operate in challenging environments

  • Protein engineering principles:

    • Application of halophilic design principles to stabilize other proteins

    • Development of computational tools for predicting salt-stable protein variants

    • Creation of a design framework for engineering proteins that function in extreme conditions

These applications could significantly expand the conditions under which biological systems can operate, potentially enabling new biotechnological solutions for energy production, environmental remediation, and industrial bioprocessing .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.