Recombinant Salinibacter ruber Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Functional Insights and Biological Role

plsY catalyzes the initial step of phospholipid biosynthesis by transferring acyl groups from acyl-phosphate to glycerol-3-phosphate, forming lysophosphatidic acid . Key functional aspects include:

  • Haloadaptation: S. ruber employs a "salt-in" strategy, accumulating intracellular K⁺/Cl⁻. plsY’s acidic proteome (high aspartate content) aligns with this hypersaline adaptation .

  • Metabolic Context: Operates alongside pathways for carotenoid synthesis (e.g., salinixanthin) and retinal-based proton pumps (xanthorhodopsin) .

Comparative Analysis with GPAT Homologs

plsY belongs to a divergent GPAT family distinct from plant or mammalian isoforms.

FeatureS. ruber plsYPlant GPATs (e.g., Arabidopsis)
Catalytic ActivityAcyl-phosphate–G3P transfer sn-2 acyltransferase/phosphatase
SubstrateAcyl-phosphateω-oxidized acyl-CoAs
RoleMembrane lipid synthesisCutin/suberin polymer assembly

Research Applications and Future Directions

  • Enzyme Kinetics: Study salt-dependent activity modulation .

  • Structural Biology: Crystallization trials using lyophilized protein .

  • Biotechnological Potential: Engineering lipid pathways in extremophiles for biofuel production .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance (additional fees apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us for preferential development.
Synonyms
plsY; SRU_1480; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Salinibacter ruber (strain DSM 13855 / M31)
Target Names
plsY
Target Protein Sequence
MWSLTVILLISYFLGSIPGALWSSKALHGVDIRNHGSHNCGATNAFRVVGWQAGALATVV DFGKGFLAAGVVASVIRIDPIPSGLSLFGGDPFVVLGLLAGVGAVIGHMYPIFARFEGGK GVNTAAGMLFALTPLTMAITLAVFVAVLLSSRYVSLSSITAAVAFPTIVALRRFGFGADL DPSLLVFGGLLALSIVVAHRSNIQRLLNGTESQISSFEPAQGMLGRGEL
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), producing lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salinibacter ruber and why is it significant for GPAT research?

Salinibacter ruber is an extremely halophilic bacterium isolated from solar salterns in Mallorca, Spain. It represents the first characterized member of the phylum Rhodothermaeota . What makes S. ruber particularly significant for enzyme research is its remarkable ability to thrive in saturated thalassic brines, which are among the most physically demanding habitats on Earth .

S. ruber has evolved convergently with halophilic Archaea (Haloarchaea), developing similar adaptations despite their phylogenetic distance . This convergence extends to both physiological and molecular levels, making its enzymes (including GPATs) valuable models for studying adaptation to extreme environments. The organism possesses a high G+C content of approximately 70 mol% , which influences codon usage and protein expression strategies when working with recombinant systems.

For GPAT research specifically, S. ruber offers a unique perspective on how these critical enzymes function under extreme salt conditions, potentially providing insights into salt-resistant catalytic mechanisms that could be applied to biotechnological applications.

How does Glycerol-3-phosphate acyltransferase function in lipid metabolism?

Glycerol-3-phosphate acyltransferase (GPAT) catalyzes the first and rate-limiting step in the de novo pathway of glycerolipid synthesis. It specifically converts glycerol-3-phosphate and long-chain acyl-CoA to lysophosphatidic acid . This reaction represents the initial committed step in the synthesis of membrane phospholipids and storage triglycerides.

In mammals, four GPAT isoforms have been identified, classified into two groups based on subcellular localization: (1) GPAT1 and GPAT2, which are localized in the mitochondrial outer membrane, and (2) GPAT3 and GPAT4, which are found in the endoplasmic reticulum membrane . The bacterial GPAT system, including the plsY acyltransferase in S. ruber, shares the fundamental catalytic function but often differs in substrate specificity and regulation.

The significance of GPATs extends beyond basic lipid synthesis, as they play pivotal roles in metabolic disorders. Studies have confirmed that GPATs are critical in the development of obesity, hepatic steatosis, and insulin resistance . This broader metabolic impact makes understanding bacterial GPATs like those from S. ruber valuable for comparative biochemical studies.

What metabolic pathways involve GPAT in the Salinibacter ruber network model?

The genome-scale metabolic network reconstruction of Salinibacter ruber (model iMB631) provides insights into the metabolic pathways involving GPAT. This comprehensive model consists of 1459 reactions, 1363 metabolites, and 631 genes . Within this network, GPAT functions at a critical junction of carbon metabolism and lipid synthesis.

Based on the metabolic model, S. ruber primarily processes glucose through the pentose phosphate pathway rather than glycolysis, which is a distinctive metabolic feature predicted by flux balance analysis . This routing of carbon influences the availability of precursors for GPAT activity, particularly glycerol-3-phosphate.

The model also reveals potential connections between GPAT activity and the organism's ability to adapt to extreme environments through membrane lipid modifications. Under certain autotrophic conditions, the model predicts that a reductive tricarboxylic acid cycle (rTCA) can support autotrophic growth , which would integrate with lipid metabolism pathways involving GPAT.

What are the cultivation requirements for obtaining Salinibacter ruber biomass?

Cultivating Salinibacter ruber for enzyme studies requires specific conditions that reflect its halophilic nature. According to the German Collection of Microorganisms and Cell Cultures (DSMZ), S. ruber DSM 13855 (type strain) requires the following cultivation parameters:

  • Medium: Medium 936 (halophilic medium)

  • Growth conditions: Liquid medium only (does not grow on solid media)

  • Temperature: 37°C

  • Incubation time: 3-7 days

  • Atmosphere: Aerobic conditions

The requirement for liquid cultivation presents challenges for isolation and colony purification but can be managed using serial dilution techniques. The relatively slow growth rate (3-7 days) must be factored into experimental timelines when planning enzyme production.

When scaling up cultures for recombinant enzyme production, it's essential to maintain these precise growth conditions throughout the cultivation process. Deviations from optimal salinity or temperature can significantly affect protein expression and folding, potentially impacting the enzymatic properties of the recombinant GPAT.

How does substrate specificity differ between GPATs from various sources?

Substrate specificity varies significantly among GPATs from different biological sources, affecting their suitability for various experimental applications. This variation is particularly evident when comparing plant, mammalian, and bacterial GPATs.

GPAT SourcePreferred SubstratesChain Length PreferenceRegiospecificityNotable Features
Arabidopsis GPAT4/6/8C16:0 and C18:1 ω-oxidized acyl-CoAsMedium-chainsn-2 positionBifunctional acyltransferase/phosphatase
Arabidopsis GPAT5Broad range of ω-oxidized and unsubstituted acyl-CoAsBroad rangesn-2 positionAssociated with suberin synthesis
Arabidopsis GPAT1Can utilize dicarboxylic acyl-CoA substrates-sn-2 positionLacks phosphatase activity
Mammalian GPATsSaturated and unsaturated acyl-CoAsLong-chainsn-1 positionRole in obesity and insulin resistance
Bacterial plsY (predicted for S. ruber)Acyl-ACP substratesSpecies-dependentsn-1 positionHalophilic adaptations expected

This diversity in substrate specificity has important implications for experimental design when studying recombinant S. ruber GPAT. The halophilic nature of S. ruber suggests its GPAT may have unique substrate preferences adapted to function in high-salt environments, potentially differing from the specificity patterns seen in mesophilic bacteria or eukaryotic systems .

What computational strategies can optimize recombinant S. ruber GPAT expression?

Optimizing recombinant expression of halophilic enzymes like S. ruber GPAT requires specialized computational approaches. Drawing from modern recombinant protein design workflows, several computational strategies can be implemented:

First, codon optimization must account for S. ruber's high G+C content (approximately 70 mol%) . This significantly differs from common expression hosts like E. coli, necessitating comprehensive codon harmonization rather than simple optimization. Analysis should focus on rare codon clusters that might cause translational pausing important for proper folding.

Second, structural modeling can predict folding challenges specific to halophilic enzymes. Halophilic proteins typically feature increased acidic residue content on their surfaces, which must be preserved during heterologous expression. Computational workflows similar to rAbDesFlow can be adapted to model protein-solvent interactions in high-salt environments .

A systematic approach should include:

  • Sequence analysis of the plsY gene from S. ruber genome (CP000159)

  • Homology modeling based on known GPAT structures

  • Molecular dynamics simulations in high-salt conditions

  • Identification of critical residues for substrate binding

  • In silico mutagenesis to evaluate potential stabilizing modifications

Machine learning algorithms can further optimize expression by analyzing successful expression patterns of other halophilic enzymes. These computational predictions should guide experimental design, particularly for choosing appropriate expression systems and purification strategies.

How can activity assays be optimized for halophilic GPAT enzymes?

Assaying GPAT activity from halophilic sources like S. ruber presents unique challenges requiring specialized methodological approaches. The enzyme's adaptation to high-salt environments necessitates carefully designed activity assays that maintain both structure and function.

Standard GPAT activity assays measure the incorporation of radiolabeled acyl-CoA into lysophosphatidic acid. For halophilic enzymes, these assays must be modified to include:

  • Buffer composition: Maintain 2-4M NaCl or KCl in all assay buffers to preserve native protein folding and activity

  • pH consideration: Test activity across pH range 7.0-9.0, as halophilic enzymes often have shifted pH optima

  • Temperature optimization: While S. ruber grows optimally at 37°C , enzyme activity should be tested from 25-50°C

  • Substrate delivery: Use appropriate detergents (e.g., Triton X-100) at concentrations that solubilize substrates without disrupting enzyme structure

For quantification, a coupled enzyme assay can be developed where the lysophosphatidic acid produced is further metabolized by a mesophilic enzyme in a second reaction that generates a colorimetric or fluorescent readout. This approach separates the high-salt reaction environment from the detection system.

When analyzing kinetic parameters, remember that halophilic enzymes often show altered kinetics compared to mesophilic counterparts. The Km values may be higher, reflecting adaptation to concentrated substrates in hypersaline environments.

What expression systems are most suitable for producing functional S. ruber GPAT?

Selecting an appropriate expression system for S. ruber GPAT requires balancing several factors specific to halophilic proteins. Based on the characteristics of S. ruber and its growth requirements , the following expression systems should be considered:

Expression SystemAdvantagesLimitationsRecommended Modifications
Haloferax volcaniiNative halophilic environment, proper foldingLower yields, specialized techniques requiredUse strong inducible promoters, optimize codon usage
E. coli BL21(DE3)High yields, well-established protocolsPotential misfolding of halophilic proteinsCo-express chaperones, use fusion tags (MBP, SUMO), lower induction temperature (16-20°C)
E. coli Rosetta-gamiHandles rare codons, enhances disulfide bond formationSlower growth, lower yieldsInclude osmolytes in growth media, purify under high salt
Cell-free systemsComplete control over reaction environmentHigher cost, technical complexityAdd high salt concentrations, optimize redox conditions

For S. ruber GPAT, an E. coli-based system with modifications represents the most practical approach for most laboratories. The key is to express the protein at low temperatures (16-20°C) after induction and to include osmolytes (betaine, ectoine) in the growth media to promote proper folding. The purification protocol must immediately transfer the protein into high-salt buffers to prevent misfolding and aggregation.

How do post-translational modifications affect S. ruber GPAT function?

While bacteria typically have fewer post-translational modifications (PTMs) than eukaryotes, halophilic bacteria like S. ruber may employ specific modifications to optimize protein function in extreme environments. These modifications can significantly impact recombinant GPAT activity and should be considered in experimental design.

Although specific PTM data for S. ruber GPAT is limited in the available literature, typical modifications in halophilic bacteria may include:

  • N-terminal processing: Removal of initiator methionine may be critical for proper folding and activity

  • Methylation: Methylation of specific residues can enhance stability in high-salt environments

  • Protein acylation: N-terminal acetylation might protect against degradation

  • Disulfide bond formation: Though less common in cytoplasmic bacterial proteins, some halophilic enzymes rely on disulfide bonds for stability

When expressing recombinant S. ruber GPAT, it's important to confirm whether the protein has the expected molecular weight using mass spectrometry analysis. Any discrepancies might indicate the presence or absence of important PTMs affecting enzymatic function.

If specific PTMs are identified as critical for function, expression systems should be selected based on their capacity to perform these modifications. Alternatively, chemical modification approaches can be employed post-purification to introduce specific modifications where necessary.

What strategies can overcome solubility challenges with recombinant S. ruber GPAT?

Halophilic proteins like S. ruber GPAT typically have distinctive amino acid compositions with an abundance of acidic residues on their surfaces, which can lead to solubility problems when expressed in conventional systems. To overcome these challenges, several specialized strategies should be considered:

  • High-salt purification approach: Immediately after cell lysis, maintain buffers at 2-4M NaCl or KCl to prevent misfolding and aggregation. This is critical as halophilic proteins are typically unstable in low-salt conditions .

  • Fusion partner strategy: Employ solubility-enhancing fusion partners specifically effective for halophilic proteins:

    • Maltose-binding protein (MBP): Particularly effective for halophilic proteins

    • SUMO tag: Enhances folding and can be precisely removed

    • Thioredoxin: Provides additional stability benefits

  • Co-expression with halophilic chaperones: Consider co-expressing S. ruber native chaperones or other halophilic chaperone systems to facilitate proper folding.

  • On-column refolding: Develop a custom purification protocol where the protein is bound to the column under denaturing conditions, then gradually exposed to increasing salt concentrations to promote proper refolding.

  • Screening multiple constructs: Create a panel of constructs with variations in:

    • N- and C-terminal boundaries

    • Internal flexible region modifications

    • Surface-exposed hydrophobic residue mutations

Each construct should be tested under various expression conditions, with particular attention to temperature (16-25°C optimal) and induction strength (lower IPTG concentrations often yield better results for challenging proteins).

How can enzyme stability be enhanced for in vitro applications of S. ruber GPAT?

Enhancing the stability of S. ruber GPAT for in vitro applications requires understanding both the halophilic nature of the enzyme and specific strategies to maintain its structure and function. Several approaches can significantly improve stability:

First, buffer optimization is critical. Beyond simply including high salt concentrations (3-4M NaCl or KCl), consider adding compatible solutes like glycine betaine, ectoine, or trehalose at 0.5-1M concentrations. These osmolytes can further stabilize protein structure without interfering with enzymatic activity .

Second, strategic protein engineering can enhance stability while preserving function. Based on comparative analysis with other halophilic enzymes, consider the following modifications:

  • Increasing surface negative charge through targeted mutagenesis

  • Introducing additional salt bridges at domain interfaces

  • Reducing exposed hydrophobic patches on the protein surface

Third, formulation with specific lipids can enhance stability. Since GPAT interacts with lipid substrates, inclusion of specific phospholipids in storage and reaction buffers can stabilize the enzyme through mimicking its native membrane environment.

A systematic stability screening approach should test the enzyme under various conditions:

Stabilization FactorTesting RangeMonitoring Method
Salt typeNaCl, KCl, mixed saltsResidual activity after time intervals
Salt concentration2-5MThermal shift assay
pH range6.0-9.0Circular dichroism
Compatible solutesVarious osmolytes at 0.5-1MAggregation monitoring
Storage temperature4°C, -20°C, -80°CActivity recovery after freeze-thaw cycles

The optimal stabilization cocktail will likely include a combination of these factors, tailored to the specific application requirements.

What are the key considerations for site-directed mutagenesis of S. ruber GPAT?

Site-directed mutagenesis of S. ruber GPAT requires careful planning to maintain the delicate balance between halophilic adaptation and catalytic function. When designing a mutagenesis strategy, several considerations are paramount:

First, identify the catalytic residues by sequence alignment with well-characterized GPATs from other organisms. The typical HX4D motif found in many acyltransferases should be preserved, as these residues are likely essential for catalytic activity regardless of the organism's halophilic nature.

Second, distinguish between residues involved in halophilic adaptation versus catalytic function. Halophilic adaptations typically include:

  • Increased acidic residues (Asp, Glu) on the protein surface

  • Reduced surface-exposed lysines

  • Fewer large hydrophobic residues on the surface

For mutagenesis design, consider the following approach:

  • Conservative mutations: Start with conservative changes that maintain charge characteristics but alter size or specific interactions

  • Domain-specific approach: Target one structural domain at a time to isolate effects

  • Surface vs. core mutations: Distinguish between surface modifications (affecting solubility) and core modifications (affecting catalytic function)

When designing primers for mutagenesis, account for the high G+C content (70 mol%) of S. ruber . This requires:

  • Longer primer sequences (30-35 nucleotides)

  • Higher annealing temperatures

  • Potential addition of DMSO or betaine to PCR reactions to reduce secondary structure formation

After mutagenesis, each variant should undergo comparative analysis:

ParameterWild-typeMutantAnalytical Method
Salt dependenceBaselineComparativeActivity assays at varying salt
Substrate specificityBaselineComparativeKinetic analysis with substrate panel
Thermal stabilityBaselineComparativeDifferential scanning calorimetry
Secondary structureBaselineComparativeCircular dichroism

This systematic approach will help distinguish mutations that affect halophilic adaptation from those impacting the catalytic mechanism.

How can structural studies enhance our understanding of S. ruber GPAT?

Structural studies of S. ruber GPAT would provide invaluable insights into both its catalytic mechanism and halophilic adaptations. Given that no crystal structure of S. ruber GPAT is currently available in the literature, a comprehensive structural biology approach is warranted.

X-ray crystallography presents particular challenges for halophilic enzymes due to the high salt requirements for protein stability. To overcome these challenges:

  • Crystallization screening should include salt gradients (2-4M NaCl or KCl) in addition to standard precipitants

  • Consider crystallization in the presence of substrate analogs or product molecules to stabilize the active site

  • Explore fusion proteins with crystallization chaperones like T4 lysozyme for problematic regions

Cryo-electron microscopy (cryo-EM) offers an alternative approach that may better preserve the native structure of halophilic proteins. For S. ruber GPAT:

  • Consider incorporating the enzyme into nanodiscs to mimic the membrane environment if membrane association is suspected

  • Use high-salt buffers during sample preparation to maintain native folding

  • Consider structural studies of the enzyme in complex with its substrates or products

Computational approaches can complement experimental structural studies:

  • Homology modeling based on known structures of GPATs from other organisms

  • Molecular dynamics simulations in high-salt environments to understand conformational stability

  • Quantum mechanics/molecular mechanics (QM/MM) studies to elucidate the catalytic mechanism

The structural data would help address several key questions:

  • How does S. ruber GPAT accommodate high salt concentrations while maintaining catalytic function?

  • What structural features determine its substrate specificity?

  • How does the structure compare to GPATs from non-halophilic organisms, particularly in surface charge distribution?

  • Are there unique structural adaptations that could be transferred to other enzymes for enhanced halotolerance?

What are the metabolic engineering applications of recombinant S. ruber GPAT?

Recombinant S. ruber GPAT offers several promising applications in metabolic engineering due to its unique properties as a halophilic enzyme. These applications span several biotechnological domains:

First, the enzyme could enable lipid production in high-salt fermentation processes. This approach has several advantages:

  • Reduced contamination risk due to selective growth conditions

  • Lower purification costs for lipid products due to phase separation

  • Potential for continuous fermentation processes using salt-tolerant systems

Second, S. ruber GPAT could be incorporated into synthetic biology platforms for producing specialized lipids. Compared to mammalian GPATs associated with obesity and metabolic disease , the bacterial enzyme might offer different substrate specificities that could be exploited for producing novel lipid structures.

Third, the halotolerant nature of S. ruber GPAT could be valuable for bioremediation applications in saline environments. Engineered microorganisms expressing this enzyme could potentially metabolize or modify contaminating hydrocarbons or lipids in salt-affected soils or waters.

Based on the genome-scale metabolic model of S. ruber (iMB631) , several specific metabolic engineering strategies could be developed:

  • Integration with the pentose phosphate pathway, which is predicted to be the primary glucose consumption route in S. ruber

  • Connection to specialized metabolite pathways, similar to the salinixanthin biosynthesis pathway that has been modeled in S. ruber

  • Potential involvement in alternative carbon fixation through the reductive tricarboxylic acid cycle under certain conditions

Each of these applications would require detailed understanding of the enzyme's kinetic parameters and regulatory properties, which should be determined experimentally as part of any metabolic engineering project.

How does S. ruber GPAT compare to analogous enzymes from other extremophiles?

Comparative analysis of S. ruber GPAT with analogous enzymes from other extremophiles provides valuable insights into convergent and divergent evolutionary adaptations to extreme environments. While specific data comparing S. ruber GPAT to other extremophilic GPATs is limited in the available literature, we can make informed comparisons based on general principles of extremophilic adaptation.

Extremophile TypeRepresentative OrganismExpected GPAT AdaptationsComparative Advantage
Halophiles (S. ruber)Salinibacter ruberAcidic surface residues, salt-dependent stability, specific ion binding sites Functional in high ionic strength environments
ThermophilesThermus thermophilusIncreased hydrophobic core packing, additional disulfide bonds, shorter surface loopsHigher thermal stability, potential for high-temperature processes
PsychrophilesPsychrobacter cryohalolentisIncreased surface flexibility, reduced proline content, weaker hydrophobic interactionsActivity at low temperatures, energy-efficient processes
AcidophilesAcidithiobacillus ferrooxidansReduced surface negative charge, stabilized acid-labile bondsFunction at low pH, acid-resistant catalysis
PiezophilesShewanella violaceaVolume-minimizing mutations, flexible protein structuresPressure-resistant activity, deep-sea applications

S. ruber's evolutionary history is particularly interesting because it shows convergent evolution with halophilic archaea despite being a bacterium . This suggests that certain adaptations for extreme halophilicity represent a limited set of solutions to the challenges of high-salt environments.

The S. ruber genome contains evidence of lateral gene transfer from haloarchaea , raising the question of whether its GPAT may have characteristics more similar to archaeal enzymes than to bacterial counterparts. Comparative studies examining substrate specificity, kinetic parameters, and structural features across these different extremophiles would provide valuable insights into the fundamental principles of enzyme adaptation to extreme environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.