Recombinant Salinibacter ruber NADH-quinone oxidoreductase subunit K (nuoK)

What is Salinibacter ruber and why is its NADH-quinone oxidoreductase of interest?

Salinibacter ruber is an extremely halophilic, red-pigmented, rod-shaped bacterium that belongs to the Bacteroidetes phylum . It is notable for several reasons:

• It represents one of the most halophilic organisms known within the domain Bacteria, with optimum growth at salt concentrations between 20-30% (200-300 g/L)

• It exhibits an archaeal-type "salt-in" haloadaptation strategy despite being a bacterium

• It can constitute 5-25% of the prokaryotic communities in hypersaline environments

The NADH-quinone oxidoreductase complex (respiratory complex I) from S. ruber is of particular interest because it represents an adaptation of electron transport systems to function in extreme salt conditions. Unlike many other bacteria, S. ruber appears to have a complete gene set related to NADH dehydrogenase complex and uses menaquinone rather than ubiquinone as an electron shuttle . This makes its respiratory components, including the nuoK subunit, valuable for understanding extremophilic adaptations in energy metabolism.

What is the structural composition of recombinant S. ruber nuoK protein?

The recombinant S. ruber NADH-quinone oxidoreductase subunit K (nuoK) has the following characteristics:

• It is encoded by the gene SRU_1444 in the S. ruber genome

• Full-length protein consists of 101 amino acids

• Amino acid sequence: MDVAPNWYLALSAVLFTIGTFGVLFRRNAIVVLMSVELMLNAVNLTLVTFSQSMGDPSGQLLVFFSIAVAAAEAAVGLAIVIAIFRSQVTVDITEINLFKH

• Available recombinant forms typically include an N-terminal His-tag for purification purposes

• The protein is a membrane-embedded component of the respiratory complex I, consistent with its hydrophobic amino acid composition

The protein's highly hydrophobic nature reflects its role as a membrane-spanning subunit within the respiratory complex.

What expression systems are recommended for producing recombinant S. ruber nuoK?

Based on available research data, the following methodological approach is recommended:

• Expression host selection: E. coli has been successfully used to express recombinant S. ruber nuoK . BL21(DE3) or similar strains designed for membrane protein expression are recommended.

• Vector design considerations:

  • Include an N-terminal His-tag for purification

  • Use a vector with a strong, inducible promoter (T7 or similar)

  • Consider codon optimization for E. coli expression, as S. ruber has a high GC content (66%)

• Expression conditions:

  • Lower temperature induction (16-20°C) may improve proper folding

  • Use lower IPTG concentrations (0.1-0.5 mM) to avoid inclusion body formation

  • Include membrane-stabilizing additives (glycerol 5-10%) in the growth medium

• Alternative systems to consider:

  • Cell-free expression systems may be advantageous for this membrane protein

  • Expression in the presence of nanodiscs or liposomes can aid proper folding

The challenges in expressing this protein relate primarily to its membrane-associated nature and the potential need for specific lipid environments to maintain native conformation.

What purification strategies are effective for recombinant S. ruber nuoK?

A methodological workflow for purification would include:

• Cell lysis and membrane fraction isolation:

  • Mechanical disruption (sonication or French press) in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 5% glycerol

  • Centrifugation at 10,000 × g to remove debris

  • Ultracentrifugation at 100,000 × g to collect membrane fraction

• Membrane protein solubilization:

  • Solubilize membrane proteins using mild detergents (n-dodecyl β-D-maltoside or CHAPS at 1-2%)

  • Incubate with gentle agitation for 1-2 hours at 4°C

  • Centrifuge at 100,000 × g to remove insoluble material

• Affinity chromatography:

  • Load solubilized protein onto Ni-NTA or similar affinity resin

  • Include low concentrations of detergent in all buffers (0.05-0.1%)

  • Use step-wise or gradient elution with imidazole (20-500 mM)

• Further purification if needed:

  • Size exclusion chromatography using a Superdex 200 column

  • Ion exchange chromatography depending on predicted pI of the protein

• Storage considerations:

  • Store purified protein in a buffer containing Tris-based buffer with 50% glycerol at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

How does the halophilic nature of S. ruber affect the structure and function of its NADH-quinone oxidoreductase complex?

The halophilic nature of S. ruber has profound implications for its respiratory complexes, including the NADH-quinone oxidoreductase:

• Protein adaptations to high salt:

  • Like other proteins from S. ruber, the nuoK subunit likely has a higher proportion of acidic amino acids, lower content of basic amino acids, and reduced hydrophobicity, similar to adaptations seen in halophilic archaea

  • These adaptations allow proteins to maintain proper folding and function in high salt environments through increased surface negative charge

• Membrane composition effects:

  • S. ruber has a unique membrane lipid composition, including a novel sulfonolipid (2-carboxy-2-amino-3-O-(13'-methyltetradecanoyl)-4-hydroxy-18-methylnonadec-5-ene-1-sulfonic acid) that constitutes approximately 10% of total cellular lipids

  • This distinct lipid environment likely affects the structure and function of membrane proteins like nuoK

• Electron transport chain adaptations:

  • S. ruber uses menaquinone (specifically MK-7) rather than ubiquinone for electron transport

  • The genome contains two clusters of cytochrome c oxidase subunit genes, with one cluster showing higher similarity to haloarchaeal homologs

• Experimental considerations:

  • Functional studies should include salt concentrations of 2-3 M NaCl to maintain protein stability

  • When reconstituting the protein into liposomes or nanodiscs, consider including the native sulfonolipids or analogous negatively charged lipids

These adaptations represent convergent evolution with halophilic archaea, despite S. ruber's bacterial phylogeny .

What experimental approaches are most effective for studying the electron transport activity of recombinant S. ruber nuoK?

To study the electron transport function of recombinant S. ruber nuoK, researchers should consider the following methodological approaches:

• Reconstitution into proteoliposomes:

  • Prepare liposomes with a lipid composition mimicking S. ruber membranes (including negatively charged phospholipids)

  • Reconstitute purified nuoK together with other subunits of complex I

  • Measure proton pumping using pH-sensitive fluorescent dyes (e.g., ACMA or pyranine)

• Electron transport activity measurement:

  • NADH:ubiquinone oxidoreductase activity can be measured spectrophotometrically by monitoring NADH oxidation at 340 nm

  • Use menaquinone analogues as electron acceptors rather than ubiquinone, as S. ruber naturally uses menaquinone (MK-7)

  • Include high salt conditions (2-3 M NaCl) to maintain protein stability

• Ion translocation assays:

  • Based on studies of similar complexes from K. pneumoniae, which showed Na+ transport with a stoichiometry of one Na+ per electron , examine whether S. ruber complex I also transports Na+ ions

  • Use 22Na+ to track ion movement or sodium-sensitive fluorescent indicators

• Inhibitor studies:

  • Examine sensitivity to known complex I inhibitors (rotenone, piericidin A)

  • Compare inhibition profiles to those of mesophilic bacterial and archaeal complex I

• Redox potential measurements:

  • Determine midpoint potentials of the cofactors in the S. ruber complex I using potentiometric titrations

  • Compare with standard complex I to identify adaptations to the halophilic environment

How can researchers incorporate recombinant S. ruber nuoK into model membrane systems to study its role in the respiratory complex?

A comprehensive methodological approach for membrane incorporation studies would include:

• Nanodisc reconstitution:

  • Select appropriate membrane scaffold proteins (MSPs)

  • Use lipid mixtures that mimic the S. ruber membrane environment, potentially including the characteristic sulfonolipid

  • Optimize protein:lipid:MSP ratios for proper incorporation

  • Verify incorporation using size exclusion chromatography and electron microscopy

• Liposome reconstitution:

  • Prepare liposomes with varying lipid compositions to determine optimal conditions

  • Use detergent removal methods (dialysis, Bio-Beads, or Sephadex columns) to incorporate the protein

  • Verify orientation using protease protection assays

  • Assess functionality using ion or electron transport assays

• Solid-supported membrane systems:

  • Utilize solid-supported bilayers for electrical measurements

  • Incorporate the protein through vesicle fusion or direct incorporation

  • Measure electron and ion transport activities through electrical current recordings

• Computational modeling:

  • Use the amino acid sequence of S. ruber nuoK to build structural models based on known complex I structures

  • Perform molecular dynamics simulations in membrane environments with varying salt concentrations

  • Identify key residues involved in protein-lipid interactions and ion transport

• Cryo-EM analysis:

  • Prepare the reconstituted protein-membrane complex for cryo-EM imaging

  • Determine structure in the presence of high salt concentrations

  • Compare with known structures of complex I from non-halophilic organisms

What are the implications of the rTCA cycle in S. ruber for understanding the function of its NADH-quinone oxidoreductase?

The presence of a reverse TCA (rTCA) cycle in S. ruber has significant implications for understanding its NADH-quinone oxidoreductase function:

• Metabolic context:

  • The rTCA cycle operates as a carbon fixation pathway in some organisms and is present in S. ruber

  • Table 4 from source details the reactions of the rTCA cycle and their related genes and enzymes in S. ruber DSM13855, including:

    • Key enzymes such as 2-oxoglutarate synthase (SRU_0424)

    • Pyruvate synthase (SRU_0423)

    • Multiple reactions that generate or consume reducing equivalents

• Electron transport chain integration:

  • The rTCA cycle generates reducing equivalents (NADH, reduced ferredoxin) that feed into the respiratory chain

  • The succinate dehydrogenase/fumarate reductase (SRU_0485, SRU_2444, SRU_0484) directly connects the rTCA cycle to the quinone pool

• Experimental considerations:

  • When studying nuoK function, consider its role within the context of the complete electron transport chain and the rTCA cycle

  • Using metabolic flux analysis, researchers can trace the electron flow from carbon fixation through the respiratory complexes

  • Investigate how salt concentration affects the coupling between the rTCA cycle and electron transport

• Evolutionary implications:

  • The presence of both a complete NADH dehydrogenase complex and the rTCA cycle suggests S. ruber may have adaptations for energy conservation in extreme environments

  • Compare the electron transport efficiency of S. ruber complex I with that of other extremophiles and mesophiles

How can site-directed mutagenesis of S. ruber nuoK inform our understanding of proton/sodium pumping in respiratory complexes?

Site-directed mutagenesis of S. ruber nuoK can provide valuable insights into ion pumping mechanisms through the following methodological approach:

• Target residue identification:

  • Align S. ruber nuoK with homologs from other organisms, particularly focusing on comparison with the Na+-transporting NADH:quinone oxidoreductase from K. pneumoniae

  • Identify conserved charged residues within transmembrane helices that might participate in ion channels

  • Use structural prediction software to map the spatial arrangement of these residues

• Mutagenesis strategy:

  • Create conservative mutations (e.g., Asp to Glu) to maintain charge but alter side-chain length

  • Create charge-neutralizing mutations (e.g., Asp to Asn) to assess the importance of charge

  • Create charge-inverting mutations (e.g., Asp to Lys) to examine electrostatic effects

  • Generate multiple mutants to examine cooperative effects

• Functional characterization methods:

  • Reconstitute mutant proteins into liposomes and measure ion transport rates

  • Compare Na+ versus H+ selectivity in wild-type and mutant proteins

  • Determine the effects of mutations on enzymatic activity (NADH:quinone oxidoreductase function)

  • Examine salt concentration dependence of activity in wild-type versus mutant proteins

• Structural studies:

  • Perform hydrogen/deuterium exchange mass spectrometry to identify conformational changes induced by mutations

  • If possible, obtain cryo-EM structures of wild-type and key mutant proteins to visualize structural changes

• Data interpretation framework:

  • Examine how mutations in S. ruber nuoK compare to similar mutations in mesophilic complex I subunits

  • Assess whether the halophilic adaptation affects the ion pumping mechanism

  • Develop models for how extremophilic environments have shaped ion pumping mechanisms

What genomic and evolutionary insights can be gained from studying S. ruber nuoK in comparison to other prokaryotes?

Comparative genomic and evolutionary analyses of S. ruber nuoK provide valuable insights:

• Evolutionary adaptations to extreme environments:

  • S. ruber shows evidence of extensive horizontal gene transfer (HGT) and homologous recombination (HR) that have shaped its genome

  • The core genome (which includes essential genes like those encoding respiratory complexes) shows evidence of being shaped extensively by HR

  • The nuoK gene can be analyzed in this context to understand how respiratory components adapt to extreme conditions

• Convergent evolution with haloarchaea:

  • Despite being a bacterium, S. ruber shows remarkable convergent evolution with haloarchaea in protein composition and salt adaptation strategies

  • nuoK can serve as a model to study how convergent evolution occurs at the molecular level in different domains of life facing similar environmental pressures

• Genomic island analysis:

  • S. ruber shows "metagenomic islands" (MGIs) - regions of high genetic variability among different strains

  • Determining whether nuoK falls within conserved regions or variable regions can provide insights into selective pressures on respiratory complexes

• Methodological approach for comparative analysis:

  • Retrieve nuoK sequences from diverse prokaryotes including extremophiles and mesophiles

  • Perform phylogenetic analyses to determine evolutionary relationships

  • Calculate selection pressures (dN/dS ratios) to identify regions under positive or purifying selection

  • Compare GC content and codon usage to identify potential HGT events

  • Analyze the genomic neighborhood of nuoK to identify conserved gene clusters or operons

• Structural comparison:

  • Generate structural models of nuoK proteins from different organisms

  • Compare electrostatic surface potentials to identify adaptations to different ionic environments

  • Examine conservation of residues involved in quinone binding and ion translocation