Recombinant Salinibacter ruber Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salinibacter ruber Protease HtpX Homolog (htpX)

Recombinant Salinibacter ruber Protease HtpX homolog (htpX) is a full-length, N-terminal His-tagged protein derived from the bacterium Salinibacter ruber, a halophilic species thriving in hypersaline environments. This recombinant protein (UniProt ID: Q2S6C2) is expressed in Escherichia coli and represents a member of the metalloprotease family (EC 3.4.24.-) based on its annotated classification . Its study is relevant for understanding extremophile biochemistry, protease evolution, and potential biotechnological applications.

Genomic and Taxonomic Context

  • Gene Locus: SRU_0106 in S. ruber DSM13855 .

  • Phylogenetic Origins: S. ruber belongs to the phylum Rhodothermaeota, with genomic features shaped by horizontal gene transfer (HGT) and homologous recombination .

Expression and Tagging

The recombinant protein is produced in E. coli with an N-terminal His tag to facilitate purification via affinity chromatography .

Physicochemical Properties

ParameterValue/DescriptionSource
Purity>90% (SDS-PAGE)
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL)
StabilityAvoid repeated freeze-thaw cycles

Enzymatic Activity

While classified as a protease (EC 3.4.24.-), no experimental data on substrate specificity, catalytic efficiency, or reaction mechanisms are reported in available literature. The function is inferred from sequence homology to metalloproteases, which typically cleave peptide bonds via metal cofactors (e.g., zinc) .

Ecological and Evolutionary Relevance

  • Haloadaptation: S. ruber employs a "salt-in" strategy, accumulating K⁺/Cl⁻ ions to maintain cytoplasmic osmotic balance . Proteases like HtpX may play roles in protein remodeling under extreme salt conditions.

  • Genomic Context: The htpX gene is part of the core genome in S. ruber, with limited sequence variation due to homologous recombination .

Potential Uses

  • Biotechnology: Hypersaline environments pose challenges for enzyme stability; HtpX homologs may serve as models for developing salt-resistant biocatalysts.

  • Immunoassays: ELISA kits targeting HtpX homologs are listed in commercial catalogs, though availability is currently restricted .

Limitations

  • Functional Data: No peer-reviewed studies validate enzymatic activity or substrate specificity.

  • Expression Yields: Commercial products emphasize recombinant expression but do not disclose yields or scalability .

References

  1. Creative Biomart. (2025). Recombinant Full Length Salinibacter ruber Protease HtpX homolog.

  2. Anagnostics. (n.d.). ELISA Recombinant Salinibacter ruber Protease HtpX homolog.

  3. CBM15. (n.d.). ELISA Recombinant Salinibacter ruber Protease HtpX homolog.

  4. PubMed. (2018). Genome Variation in Salinibacter ruber.

  5. PubMed. (2005). The Genome of Salinibacter ruber.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
htpX; SRU_0106; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Salinibacter ruber (strain DSM 13855 / M31)
Target Names
htpX
Target Protein Sequence
MNTFRTTALMAVMIVLFALIGQALGGTGGMLLAFLIAVGMNGVSYWYSSSIVLRMYGAEE VSRAEAPELHDLVDRLRRRADLPMPKVCIIPQDQPNAFATGRNPDNAVVAVTKGIMDVLD RDELAGVIAHELAHIKNRDMLTSTVAATLAGAITMLSRFALFFGGRDNNFLVSLLMMILA PMAAMLIQSAISRSREYAADREGAEIAKNPLGLASALRSMERAAEHRPMPANQTTSHMFI VNPFSGGLSGIKRLFSTHPPTEERIARLEEMAGRAQ
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salinibacter ruber and why is it significant in extremophile research?

Salinibacter ruber is a brightly red-pigmented, extremely halophilic bacterium isolated from saltern crystallizer ponds in Spain. It is among the most halophilic organisms within the domain Bacteria, requiring at least 15% salt concentration for growth, with optimal growth occurring between 20-30% salt concentrations . Its significance lies in being a major component of halophilic communities worldwide, contributing between 5-25% of the prokaryote community in saltern crystallizers .

As an extremely halophilic bacterium related to the order Cytophagales, S. ruber has become one of the main models for ecological and evolutionary studies of bacterial adaptation to hypersaline environments . Its unique physiological characteristics include an extremely high potassium content, with K⁺/protein ratios comparable to halophilic Archaea . This makes S. ruber particularly valuable for studying osmotic adaptation mechanisms in Bacteria compared to Archaea.

What is the general function of Protease HtpX homologs in bacterial systems?

Protease HtpX homologs function as membrane-bound zinc metalloproteases that participate in the proteolytic quality control of membrane proteins. Based on studies in Escherichia coli, HtpX works in conjunction with FtsH, a membrane-bound ATP-dependent protease, to maintain membrane protein homeostasis .

HtpX exhibits several key enzymatic characteristics:

  • It functions as a zinc-dependent endoprotease

  • It demonstrates self-cleavage activity when supplemented with Zn²⁺

  • It can degrade both membrane proteins (like SecY) and soluble proteins (like casein)

  • It undergoes self-degradation upon cell disruption or membrane solubilization

In terms of stress response, HtpX typically functions as part of the cellular response to membrane protein stress and heat shock, with its expression often regulated by stress conditions.

What are the recommended storage and handling protocols for recombinant S. ruber HtpX?

For optimal preservation of recombinant S. ruber HtpX activity, the following storage and handling protocols are recommended:

ParameterRecommendation
Storage temperature-20°C/-80°C for long-term storage
Working aliquotsStore at 4°C for up to one week
Storage bufferTris-based buffer with 50% glycerol, pH 8.0
FormTypically provided as lyophilized powder
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL
Post-reconstitutionAdd 5-50% glycerol (final concentration) and aliquot for long-term storage
Important precautionsAvoid repeated freeze-thaw cycles

For experimental use, it's recommended to briefly centrifuge the vial prior to opening to bring contents to the bottom. The default final concentration of glycerol recommended for storage is typically 50% .

How is HtpX expression in Salinibacter ruber regulated in response to salt stress compared to other halophiles?

In Salinibacter ruber, the transcription of htpX (HELO_2012) shows a negative correlation with salt concentration . This pattern differs from the regulation of many other stress-related genes in halophilic bacteria.

Comparative analysis with the closely related halophile Chromohalobacter salexigens reveals interesting differences in stress response patterns:

Stress-related gene groupsS. ruber/H. elongata responseC. salexigens responseSimilarity between species
HtpX proteaseNegative correlation with saltDifferentially expressedSimilar pattern
Heat shock proteinsOnly ibpA upregulated at low saltMultiple proteins differentially expressedLow similarity (1 of 15 homologs showed similar expression)
RpoH (sigma factor)Upregulated at low saltUpregulated at low saltSimilar pattern
Chemotaxis genesDownregulated with increasing saltDownregulated with increasing saltHigh similarity (>90% of homologs)

What experimental approaches are recommended for studying the proteolytic activity of recombinant S. ruber HtpX?

Based on successful approaches with E. coli HtpX , the following experimental methodology is recommended for studying S. ruber HtpX proteolytic activity:

  • Purification strategy:

    • Purify under denaturing conditions to prevent self-degradation

    • Refold in the presence of a zinc chelator

    • Supplement with Zn²⁺ to activate the enzyme when required for assays

  • Proteolytic activity assays:

    • Self-cleavage activity: Monitor the self-degradation of HtpX in the presence of Zn²⁺

    • Soluble substrate degradation: Use casein as a model substrate and assess degradation via SDS-PAGE or fluorescently labeled casein

    • Membrane protein degradation: Express potential membrane protein substrates (like SecY) and assess cleavage patterns

  • In vivo verification:

    • Co-express S. ruber HtpX with potential substrates in a heterologous system

    • Analyze degradation patterns via Western blotting

  • Zinc dependency confirmation:

    • Perform activity assays in the presence of varying concentrations of Zn²⁺

    • Use zinc chelators (like EDTA) as negative controls

    • Test other metal ions to determine specificity

Controls should include heat-inactivated enzyme preparations and site-directed mutants of the predicted catalytic residues to confirm enzymatic activity is specific to the HtpX protease function.

How does the genomic context of htpX in S. ruber contribute to understanding its evolutionary adaptation to hypersaline environments?

The genomic context of htpX in Salinibacter ruber provides valuable insights into its evolutionary adaptation to hypersaline environments. S. ruber has an open pangenome with contrasting evolutionary patterns in the core and accessory genomes .

The core genome, where essential genes like htpX are typically found, is shaped by extensive homologous recombination (HR), which results in limited sequence variation within population clusters. In contrast, the accessory genome is modulated by horizontal gene transfer (HGT), with genomic islands and plasmids serving as gateways to the rest of the genome .

Comparative genomic analysis of eight S. ruber strains isolated from different Mediterranean solar salterns revealed that genes differentially impacted by these genetic exchange processes are often functionally relevant for environmental interactions and adaptation to extremophilic conditions .

The htpX gene, being differentially expressed in response to salt stress , likely plays a role in S. ruber's adaptation to its extreme environment. Its regulation as part of the protein folding stress response suggests it helps maintain membrane protein homeostasis under varying salt conditions. This is particularly important considering that S. ruber has an extremely high intracellular K⁺ concentration and needs specialized membrane proteins to maintain this ionic environment .

What methodological approaches are recommended for investigating HtpX substrate specificity in halophilic systems?

Investigating HtpX substrate specificity in halophilic systems requires specialized approaches that account for the high-salt environment. Recommended methodological approaches include:

  • Proteomics-based identification of substrates:

    • Express tagged HtpX in S. ruber or heterologous halophilic hosts

    • Create catalytically inactive mutants (to trap substrates)

    • Use comparative proteomics between wild-type and HtpX-deficient strains under various salt conditions

    • Employ stable isotope labeling (SILAC) to quantify protein degradation rates

  • In vitro degradation assays under halophilic conditions:

    • Perform assays in buffers mimicking the high K⁺ intracellular environment of S. ruber

    • Test candidate membrane proteins isolated from S. ruber

    • Monitor degradation patterns via SDS-PAGE and mass spectrometry

  • Substrate validation approaches:

    • Create fusion proteins with potential cleavage sites and fluorescent reporters

    • Monitor cleavage through fluorescence resonance energy transfer (FRET) assays

    • Perform site-directed mutagenesis of predicted cleavage sites to confirm specificity

  • Computational prediction of substrates:

    • Analyze the S. ruber proteome for proteins with structural features similar to known HtpX substrates

    • Focus on membrane proteins with potential quality control requirements

    • Generate structural models to identify accessible cleavage sites

These approaches should be performed under varying salt concentrations (15-30%) to understand how substrate specificity might change under different environmental conditions relevant to S. ruber's natural habitat.

What are the recommended experimental controls when working with recombinant S. ruber HtpX in proteolytic assays?

When designing rigorous proteolytic assays with recombinant S. ruber HtpX, the following experimental controls are essential:

  • Negative controls:

    • Heat-inactivated enzyme preparation (95°C for 10 minutes)

    • Catalytically inactive mutant (mutation in zinc-binding motif)

    • Assay buffer with Zn²⁺ chelator (e.g., EDTA, 5-10 mM)

    • Substrate only (no enzyme) incubated under identical conditions

  • Positive controls:

    • Commercial protease with broad specificity (e.g., Proteinase K)

    • Well-characterized metalloproteases (e.g., thermolysin)

    • If available, E. coli HtpX for comparative analysis

  • Salt concentration controls:

    • Perform assays across a range of salt concentrations (0-30%)

    • Include physiologically relevant salt concentrations for S. ruber (15-30%)

    • Test different salt types (NaCl vs. KCl) to mimic extracellular vs. intracellular environments

  • Specificity controls:

    • Test non-specific protein substrates (e.g., BSA, casein)

    • Include structurally similar substrates with mutations at predicted cleavage sites

    • Test degradation of denatured vs. native substrates

  • Metal ion dependency controls:

    • Test activity with different divalent metal ions (Mn²⁺, Ca²⁺, Mg²⁺, Co²⁺)

    • Use increasing concentrations of Zn²⁺ to establish optimal conditions

    • Include zinc-binding competitors to confirm specific zinc dependency

These controls will ensure that observed proteolytic activity is specifically attributable to the recombinant S. ruber HtpX and will help characterize its enzymatic properties in a rigorous scientific manner.

How should researchers interpret changes in HtpX activity under varying salt conditions?

When interpreting changes in S. ruber HtpX activity under varying salt conditions, researchers should consider multiple factors:

  • Expression level context:
    The htpX gene shows negative correlation with salt concentration in halophiles . Therefore, any activity changes observed must be interpreted in the context of altered expression levels versus direct effects on enzyme activity.

  • Direct vs. indirect effects on enzyme activity:

    • Direct effects: Salt concentration may directly affect enzyme folding, stability, and catalytic activity

    • Indirect effects: Salt may alter substrate conformation or enzyme-substrate interactions

  • Physiological relevance:
    Activity patterns should be interpreted in the context of S. ruber's natural salt range (15-30% optimal) . Activity changes may reflect evolutionary adaptations to its hypersaline niche.

  • Comparative analysis framework:
    Compare results with:

    • Other proteases from S. ruber

    • HtpX homologs from non-halophilic bacteria

    • Other stress response proteins in S. ruber

  • Substrate-dependent variations:
    Salt may affect activity differently depending on substrate type (membrane vs. soluble proteins). Comprehensive testing with multiple substrates is recommended for accurate interpretation.

For robust data interpretation, activity measurements should be normalized to enzyme concentration, and dose-response curves for both salt and substrate should be generated to distinguish between effects on enzyme-substrate binding versus catalytic efficiency.

What are common challenges in purifying active recombinant S. ruber HtpX and how can they be addressed?

Purifying active recombinant S. ruber HtpX presents several challenges similar to those encountered with E. coli HtpX, with additional complications due to its halophilic origin:

ChallengeSolutionRationale
Self-degradation during purificationPurify under denaturing conditions (6-8M urea)Prevents proteolytic activity during purification
Maintaining stability during refoldingRefold in the presence of zinc chelatorsPrevents premature activation and self-degradation
Low expression in standard hostsUse specialized halophilic expression systemsBetter compatibility with halophilic proteins
Protein aggregationInclude osmolytes (glycerol, betaine) in buffersEnhances stability of halophilic proteins
Salt-dependent solubilityMaintain moderate salt concentration (5-10%)Balances solubility with activity
Degradation of fusion tagsUse N-terminal tags and rapid purificationMinimizes exposure to self-proteolysis
Zinc dependencyAdd Zn²⁺ only after purificationControls activation timing
Loss of activity during storageStore with 50% glycerol at -20°C/-80°CPrevents freeze-thaw damage and protein denaturation

A recommended purification workflow would be:

  • Express with an N-terminal His-tag in E. coli

  • Solubilize membranes with detergent in the presence of chelators

  • Purify under denaturing conditions using immobilized metal affinity chromatography

  • Refold by gradual dialysis in the presence of chelators

  • Add Zn²⁺ only when activity is desired for experimental assays

This approach addresses the key challenges while maximizing the yield of active enzyme for research applications.

How might the study of S. ruber HtpX contribute to understanding extremozyme adaptations in biotechnology?

The study of S. ruber HtpX offers valuable insights into extremozyme adaptations with significant biotechnological implications:

  • Structural adaptations for extreme conditions:
    Characterizing how S. ruber HtpX maintains stability and activity in high salt conditions could inform the design of enzymes for industrial processes requiring high salt, organic solvents, or extreme pH conditions.

  • Novel protease applications:
    As a zinc-dependent metalloprotease with activity in high salt conditions, S. ruber HtpX could serve as a template for engineered proteases with applications in:

    • Detergent formulations for high-salt washing conditions

    • Food processing in high-salt environments

    • Bioremediation of saline industrial waste

  • Membrane protein quality control mechanisms:
    Understanding HtpX's role in membrane protein degradation could inform approaches to:

    • Improve recombinant membrane protein production

    • Develop strategies to modulate membrane protein degradation in biotechnological applications

    • Engineer cells with enhanced stress tolerance

  • Halophilic protein engineering principles:
    Comparative analysis of S. ruber HtpX with non-halophilic homologs may reveal key residues and structural features that confer halotolerance, informing rational design strategies for enzyme halostabilization.

  • Protein quality control in synthetic biology:
    HtpX's role in membrane protein quality control makes it a potential regulatory component for synthetic biology applications requiring precise control of membrane protein expression and turnover.

Future research should focus on detailed characterization of S. ruber HtpX's substrate specificity, catalytic mechanism, and structural features that enable function in extreme salt conditions, potentially leading to novel biotechnological applications.

What methodological approaches are recommended for studying the role of HtpX in S. ruber's stress response network?

To comprehensively investigate HtpX's role in S. ruber's stress response network, researchers should implement a multi-faceted approach:

  • Systems biology approaches:

    • Transcriptomics: RNA-seq analysis comparing wild-type and htpX knockout strains under various stress conditions

    • Proteomics: Quantitative proteomics to identify changes in protein abundance and post-translational modifications

    • Metabolomics: Analysis of metabolic changes associated with htpX deletion or overexpression

    • Network analysis: Integration of multi-omics data to position HtpX within the broader stress response network

  • Genetic manipulation strategies:

    • Generate htpX knockout mutants using CRISPR-Cas or similar gene editing tools

    • Create conditional expression systems for htpX to control its expression levels

    • Develop reporter gene fusions to monitor htpX expression in real-time

    • Perform complementation studies with htpX from different bacterial species

  • Biochemical interaction studies:

    • Identify HtpX protein interaction partners using pull-down assays or bacterial two-hybrid systems

    • Map substrates using techniques like SILAC combined with proteomics

    • Investigate potential regulatory interactions with other stress response proteins

  • Physiological stress response measurements:

    • Assess growth kinetics of wild-type versus htpX mutants under various stress conditions

    • Measure membrane integrity and protein misfolding rates

    • Evaluate cell viability following acute stress exposure

  • Comparative studies across halophiles:

    • Compare HtpX function across different halophilic bacteria

    • Analyze evolutionary conservation patterns of HtpX and its interacting partners

    • Assess functional complementation between HtpX from different species

These approaches should be conducted across a range of salt concentrations (15-30%) and combined with other stress factors (temperature, pH, oxidative stress) to develop a comprehensive understanding of HtpX's role in S. ruber's adaptive responses to environmental challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.