Recombinant Salinibacter ruber Protoheme IX farnesyltransferase (ctaB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you require a specific format, please indicate your preference when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50% and can serve as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
ctaB; SRU_2369; Protoheme IX farnesyltransferase; Heme B farnesyltransferase; Heme O synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Salinibacter ruber (strain DSM 13855 / M31)
Target Names
ctaB
Target Protein Sequence
MLWDYLILAKPEISSVVTLSAFAGFLIGSPTGLDGGTLLWTMLGTALCAGGVGTLNHVLE RRYDAQMKRTAQRPLPAGRADPKMARRVGILLVCLAVGLLCPLVNVLTAVLAALTAVLYL FVYTPLKRTTKWNTLVGTVPGALPALGGYTAATGHLGAGGWATFGILATWQMPHFLSLAW MYRKDYARGDYAMLPVVEPDGNSTAAQMIGFAALLVPVSVLPVLTEAAGWIYGVGVVPLG LWFLWTTIVFHGERTGQKAKRVLKASVLYIPGLVALLLVDWFL
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of heme B (protoheme IX) to heme O. This transformation involves substituting the vinyl group on carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group.
Database Links
Protein Families
UbiA prenyltransferase family, Protoheme IX farnesyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salinibacter ruber and why is it significant for protoheme IX farnesyltransferase research?

Salinibacter ruber is a halophilic bacterium that represents a major component of the bacterial fraction in salterns and is commonly isolated from hypersaline habitats worldwide . It has emerged as an excellent model for microdiversity studies due to its abundance in hypersaline waters and its high intraspecific genomic and functional diversity . This bacterium offers unique advantages for studying extremophilic adaptations, including specialized proteins like Protoheme IX farnesyltransferase.

The significance of S. ruber for protoheme IX farnesyltransferase research stems from its evolutionary adaptations to extreme environments. As a halophilic bacterium living in high-salt conditions, its enzymes (including ctaB) have evolved specialized properties that allow them to function under conditions that would denature most proteins. This makes S. ruber's ctaB particularly interesting for comparative structural and functional studies among extremophiles.

What are the recommended isolation and cultivation methods for Salinibacter ruber?

Isolating and cultivating Salinibacter ruber requires specialized techniques due to its halophilic nature. Based on established protocols, the following methodology is recommended:

  • Sample collection: Obtain samples from hypersaline environments such as solar salterns with salt concentrations approaching saturation (25-30%) .

  • Isolation medium: Use SW 25% medium (25% total salts) supplemented with 0.2% yeast extract .

  • Initial cultivation: Set up pre-inocula from individual colonies into 10 ml tubes with 1 ml SW 25% supplemented with 2 g/l yeast extract and incubate for at least 10 days at 37°C in an orbital shaker (170 rpm) .

  • Scale-up cultivation: Transfer to larger volumes (e.g., 500 ml) of 25% salt medium supplemented with 0.2% yeast extract, inoculated at 5% .

  • Growth conditions: Maintain cultures at 37°C in an orbital shaker (170 rpm) until mid-exponential phase (OD 600 = 0.5) .

  • Strain verification: Confirm strain identity using molecular techniques such as 16S rRNA gene sequencing, MALDI-TOF MS, or RAPD signatures .

How does genomic variation in S. ruber affect ctaB expression and function?

Salinibacter ruber exhibits substantial intraspecific genomic diversity, which has implications for gene expression and protein function across different strains. Comparative genomic analysis reveals that S. ruber has an open pangenome with contrasting evolutionary patterns in core and accessory genomes . The core genome is shaped by extensive homologous recombination (HR), while the accessory genome is modulated by horizontal gene transfer (HGT) .

For researchers investigating ctaB expression and function across different S. ruber strains, consider the following methodological approaches:

  • Comparative genomics: Analyze the ctaB gene sequence across multiple S. ruber strains to identify potential variations. Studies have shown that core genes like ctaB may still exhibit sequence variations that could affect enzyme properties .

  • Transcriptomic analysis: Implement RNA-seq to quantify ctaB expression under different environmental conditions. Previous studies have demonstrated that S. ruber exhibits significant transcriptomic diversity even among co-occurring strains .

  • Protein structure prediction: Utilize homology modeling to predict how amino acid variations might affect protein structure and function, particularly focusing on active site residues involved in substrate binding or catalysis.

  • Enzymatic activity assays: Develop comparative biochemical assays to measure the activity of recombinant ctaB from different strains under varying salt concentrations and temperatures to assess functional diversity.

S. ruber StrainOriginGenome Size (bp)G+C Content (%)ORF Count
Type strainsVarious~3,828,264~65.83~3,369
Environmental isolatesSalternsVariable65.5-66.0Variable

What environmental factors influence ctaB expression in Salinibacter ruber?

Environmental factors likely have significant effects on ctaB expression in S. ruber, particularly given its habitat in extreme environments. Research approaches to investigate these influences should consider:

  • Experimental design: Use controlled mesocosm experiments similar to those conducted in Mallorca salterns, where factors such as UV radiation and salinity can be systematically varied .

  • Multi-stressor experiments: Design studies that investigate the combined effects of environmental stressors on gene expression. Previous research has used experimental ponds with different treatments: control conditions, altered sunlight intensity (37-fold reduction or increase), and abrupt changes in salt concentration (from ~34% to ~12%) .

  • Time-course analysis: Monitor changes in ctaB expression over time following environmental perturbations. Studies on S. ruber have shown that monitoring at multiple time points (e.g., one day, one week, and one month post-treatment) provides valuable insights into adaptation processes .

  • Quantitative PCR: Implement qPCR to measure changes in ctaB transcript levels in response to environmental variables, normalizing against appropriate reference genes.

  • Proteomics: Use LC-MS/MS to quantify ctaB protein abundance under different conditions, which may not always correlate with transcriptional changes.

What are the optimal methods for producing and purifying recombinant S. ruber Protoheme IX farnesyltransferase?

Production and purification of recombinant S. ruber Protoheme IX farnesyltransferase presents unique challenges due to the halophilic nature of the source organism. Recommended methodological approaches include:

  • Expression system selection: Consider using specialized expression systems designed for halophilic proteins, such as modified E. coli strains or Haloferax volcanii-based systems. Standard E. coli expression systems may require optimization of salt conditions.

  • Codon optimization: Optimize the ctaB gene sequence for the chosen expression system, taking into account the high G+C content (~65.83%) of S. ruber genes .

  • Fusion tags: Incorporate appropriate fusion tags to enhance solubility and facilitate purification. The most suitable tag will need to be determined during the production process .

  • Protein stabilization: Maintain high salt concentrations throughout the purification process to prevent protein denaturation, as halophilic proteins often require salt for proper folding.

  • Storage conditions: Store purified protein in Tris-based buffer with 50% glycerol optimized for stability at -20°C for short-term storage or -80°C for extended storage . Avoid repeated freezing and thawing cycles.

  • Quality control: Validate protein identity and purity using mass spectrometry, and assess functionality through appropriate enzymatic assays specific to Protoheme IX farnesyltransferase activity.

How can researchers investigate the role of ctaB in S. ruber's adaptation to hypersaline environments?

Investigating the role of ctaB in Salinibacter ruber's adaptation to hypersaline environments requires multidisciplinary approaches:

  • Comparative analysis: Compare ctaB gene sequences and expression levels across S. ruber strains isolated from environments with different salinity levels. Previous studies have isolated S. ruber from multiple locations, providing a foundation for such comparisons .

  • Gene knockout/complementation: Develop genetic tools for S. ruber to create ctaB knockout mutants, followed by complementation studies to confirm phenotypes. Note that genetic manipulation of extremophiles presents technical challenges requiring specialized protocols.

  • Heterologous expression: Express S. ruber ctaB in model organisms with controllable salt tolerance to isolate the specific contribution of this enzyme to salt adaptation.

  • Structural biology: Determine the three-dimensional structure of S. ruber ctaB using X-ray crystallography or cryo-EM to identify structural adaptations that enable function in high-salt environments.

  • Metabolomics: Profile heme-related metabolites in S. ruber under varying salt concentrations to understand how ctaB activity influences the organism's metabolic response to salinity changes.

What are the evolutionary implications of ctaB diversity within the S. ruber pangenome?

The evolutionary analysis of ctaB diversity within the Salinibacter ruber pangenome offers insights into adaptation mechanisms in extreme environments:

  • Phylogenetic analysis: Construct phylogenetic trees based on ctaB sequences from diverse S. ruber strains to trace evolutionary relationships and identify potential horizontal gene transfer events.

  • Selection pressure analysis: Calculate dN/dS ratios for ctaB sequences to determine whether the gene is under purifying, neutral, or positive selection in hypersaline environments.

  • Comparative genomics: Analyze the genomic context of ctaB across different strains to identify conserved gene neighborhoods or association with genomic islands, which might indicate horizontal gene transfer .

  • Population genomics: Implement population-level sequencing to characterize the frequency and distribution of ctaB variants in natural populations of S. ruber from different hypersaline habitats.

  • Experimental evolution: Design long-term evolution experiments under controlled laboratory conditions to observe real-time evolution of ctaB in response to varying selection pressures.

The evolutionary patterns observed may reflect broader evolutionary scenarios that conciliate "Neutral" and "Constant Diversity" models of bacterial evolution , providing valuable insights into microbial adaptation mechanisms.

What analytical techniques are most effective for characterizing the enzymatic activity of recombinant ctaB?

Characterizing the enzymatic activity of recombinant Protoheme IX farnesyltransferase requires specialized analytical techniques:

  • Substrate preparation: Purify protoheme IX and farnesyl pyrophosphate as substrates for activity assays. Consider isotopically labeled substrates for more detailed mechanistic studies.

  • UV-visible spectroscopy: Develop spectrophotometric assays based on the characteristic absorption spectra of heme B and heme O to monitor reaction progress.

  • HPLC analysis: Implement reverse-phase HPLC methods to separate and quantify substrate and product concentrations, preferably coupled with diode array detection for spectral confirmation.

  • Mass spectrometry: Utilize LC-MS/MS for definitive identification and quantification of reaction products, with particular attention to mass transitions specific to farnesylated heme products.

  • Enzyme kinetics: Determine kinetic parameters (Km, Vmax, kcat) under varying conditions of pH, temperature, and salt concentration to characterize the enzyme's catalytic properties in relation to its halophilic nature.

  • Inhibition studies: Screen potential inhibitors to probe the enzyme's active site architecture and develop tools for functional studies in vivo.

How can researchers analyze the interaction between ctaB and the membrane environment in S. ruber?

Analyzing the interaction between Protoheme IX farnesyltransferase and the membrane environment in Salinibacter ruber requires specialized techniques that address membrane-protein interactions:

  • Membrane fraction preparation: Develop protocols for isolating membrane fractions from S. ruber that preserve native protein-lipid interactions.

  • Localization studies: Implement immunogold electron microscopy or fluorescence microscopy with tagged ctaB to determine its precise subcellular localization.

  • Lipid composition analysis: Characterize the lipid environment surrounding ctaB using lipidomics approaches, as halophilic organisms often have unique membrane compositions that facilitate protein function in high-salt environments.

  • Reconstitution studies: Reconstitute purified ctaB into liposomes of defined composition to investigate the influence of specific lipids on enzyme activity.

  • Molecular dynamics simulations: Develop computational models of ctaB in membrane environments to predict protein-lipid interactions and identify amino acid residues that mediate these interactions.

  • Cross-linking studies: Apply chemical cross-linking followed by mass spectrometry to identify proteins that interact with ctaB in the membrane environment.

What emerging technologies could advance our understanding of ctaB function in extremophiles?

Several emerging technologies offer promising avenues for advancing research on Protoheme IX farnesyltransferase in extremophiles:

  • CRISPR-Cas genome editing: Adapt CRISPR-Cas systems for genetic manipulation of S. ruber to enable precise modification of the ctaB gene. This would facilitate structure-function studies through targeted mutagenesis.

  • Single-cell 'omics: Apply single-cell transcriptomics and proteomics to analyze cell-to-cell variation in ctaB expression within S. ruber populations, providing insights into functional heterogeneity.

  • Cryo-electron microscopy: Utilize advances in cryo-EM to determine high-resolution structures of ctaB in different functional states, potentially revealing conformational changes associated with catalysis.

  • Nanopore sequencing: Implement long-read sequencing technologies to improve genome assemblies of S. ruber strains, facilitating more accurate comparative genomics of the ctaB gene region.

  • Synthetic biology: Apply synthetic biology approaches to engineer ctaB variants with enhanced stability or altered substrate specificity, potentially leading to biotechnological applications.

  • Microfluidics: Develop microfluidic systems for high-throughput screening of ctaB activity under precisely controlled environmental conditions that mimic natural hypersaline habitats.

What interdisciplinary approaches could enhance our knowledge of ctaB's role in microbial adaptation?

Interdisciplinary research approaches offer powerful means to deepen our understanding of how Protoheme IX farnesyltransferase contributes to microbial adaptation in extreme environments:

  • Systems biology: Integrate transcriptomics, proteomics, and metabolomics data to build comprehensive models of how ctaB functions within broader cellular networks in S. ruber.

  • Ecological genomics: Combine environmental monitoring with genomic analysis to correlate ctaB sequence variants with specific ecological parameters in natural hypersaline environments.

  • Structural bioinformatics: Apply computational approaches to predict how specific amino acid changes in ctaB might confer adaptive advantages in different environmental conditions.

  • Comparative biochemistry: Conduct parallel studies of ctaB orthologs from diverse extremophiles to identify convergent and divergent evolutionary adaptations.

  • Astrobiology: Investigate S. ruber ctaB as a model for understanding how essential enzymes might function in extraterrestrial environments with extreme conditions.

  • Synthetic ecology: Create simplified microbial communities including S. ruber to study how ctaB function influences species interactions in controlled hypersaline environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.