Recombinant Salinibacter ruber Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please include your desired format in the order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
uppP; SRU_0337; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Salinibacter ruber (strain DSM 13855 / M31)
Target Names
uppP
Target Protein Sequence
MTWWEALLLGLIQGLTEFIPVSSSGHLVLGQYLLGLDKEAADVTFEVFVHFGTVLSILTV YWDDVAELVEEAWAGLRAPRAVPTRFAENDTFRLGVFILVTLVPTGVAYVLFREPLEQAF GSPRFTSAMLVGTGVLLLLTRIGPRPDGDLSGVKAFVVGVAQSCALVPGISRSGATICTA LYQNVAPERAANFSFLMLLPVVLGGTVLKGLELMEQGVGAAGLSLGIGTVAAYGSGIGAI YVVLDVVRRGNLQYFAYYCFLIGGLGLWLL
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salinibacter ruber and why is it significant for microbiological research?

Salinibacter ruber is a halophilic bacterium that serves as an excellent model for microdiversity and microevolutionary studies, particularly regarding adaptation to extreme environments. It exists in most hypersaline waters worldwide, including saltern pond crystallizers, often as the most abundant bacterial species. The organism exhibits high intraspecific genomic and functional diversity at both transcriptomic and metabolomic levels, even among co-occurring strains. This diversity makes S. ruber particularly valuable for studying microbial adaptation to extreme conditions such as high salinity environments .

What is the biological function of Undecaprenyl-diphosphatase (uppP) in bacterial cells?

Undecaprenyl pyrophosphate phosphatase (UppP) is an integral membrane protein that plays a critical role in bacterial cell wall synthesis. It catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate (UndP), which functions as an essential carrier lipid in the bacterial cell wall synthesis pathway. This carrier lipid is responsible for transporting most glycans and glycopolymers across the cytoplasmic membrane, including peptidoglycan precursors, O-antigen, capsule, wall teichoic acids, and various sugar modifications .

What structural features characterize the active site of UppP?

The enzyme active site of UppP contains two critical consensus regions: (E/Q)XXXE motif and PGXSRSXXT motif, along with a conserved histidine residue. Topological modeling suggests these regions are localized near the aqueous interface of UppP and face the periplasm, indicating the enzyme's catalytic function occurs on the outer side of the plasma membrane. Mutagenesis analysis has demonstrated that mutations in these regions (specifically E17A/E21A, H30A, S173A, R174A, and T178A) result in complete inactivation of the enzyme, confirming that these consensus regions constitute the catalytic site of UppP .

What expression systems are recommended for producing recombinant S. ruber UppP?

When expressing recombinant S. ruber UppP, researchers have successfully used bacteriorhodopsin as a fusion tag at the N-terminus of the target proteins. This approach has been particularly effective for the expression and purification of recombinant UppP. Expression vectors harboring the Hmbop1/D94N-uppP gene have been employed in E. coli systems. When designing expression constructs, it's important to consider the integrity of transmembrane domains, as UppP is an integral membrane protein. Alternative expression hosts may include Bacillus subtilis systems, especially when investigating stress-response pathways that involve undecaprenyl phosphate metabolism .

What cofactors and conditions are required for optimal UppP enzyme activity in vitro?

Enzymatic analysis has demonstrated an absolute requirement for divalent metal ions, specifically magnesium or calcium ions, for UppP activity. In vitro assays should therefore include these cofactors at physiologically relevant concentrations (typically 1-10 mM). The enzyme functions optimally in membrane environments, so including appropriate phospholipids or detergent micelles in the reaction buffer is essential for maintaining activity. Since UppP is adapted to function in the halophilic environment of S. ruber, high salt concentrations (20-25% NaCl) may be necessary to maintain proper protein folding and function, particularly when working with the native enzyme from S. ruber rather than heterologously expressed variants .

How can researchers validate the functional activity of recombinant UppP?

The table below outlines multiple approaches for validating UppP activity:

Validation MethodExperimental ApproachAdvantagesLimitations
Phosphate Release AssayMeasure inorganic phosphate released during dephosphorylationSimple, quantitativeIndirect measurement
Substrate DepletionHPLC analysis of undecaprenyl pyrophosphate consumptionDirect measurement of substrateRequires specialized equipment
Product FormationLC-MS detection of undecaprenyl phosphateDirect measurement of productComplex analysis
Complementation AssaysRescue of UppP-deficient bacterial strainsConfirms in vivo functionMay not work across species
Bacitracin ResistanceMeasure resistance to bacitracin antibioticsPhysiologically relevantIndirect functional measure

These approaches can be used individually or in combination to confirm that the recombinant enzyme is properly folded and catalytically active .

How does the genomic context of uppP in S. ruber compare to other bacterial species?

In S. ruber, the genomic analysis reveals that uppP (SRU_0337) exists within a dynamic genomic landscape. Unlike many bacterial species that have a single copy of uppP, genetic analysis of multiple S. ruber strains shows evidence of horizontal gene transfer (HGT) and recombination events affecting the uppP genomic region. The core genome of S. ruber, which includes uppP, is shaped extensively by homologous recombination (HR), resulting in limited sequence variation within population clusters. In contrast, the accessory genome is modulated by horizontal gene transfer, with genomic islands and plasmids acting as gateways for genetic exchange. This genetic mobility is regulated by restriction and modification (RM) or CRISPR-Cas systems, which influence the frequency and extent of recombination events .

What computational approaches are most effective for modeling the structure-function relationship of UppP?

Three-dimensional structural modeling and molecular dynamics simulation studies have proven valuable for elucidating the structure-function relationship of UppP. The Rosetta membrane ab initio approach has been successfully used to construct 3D models of UppP. These computational models have provided insights into enzyme-substrate interactions within membrane bilayers. The modeling approaches should incorporate the known consensus regions ((E/Q)XXXE and PGXSRSXXT motifs) and consider the membrane topology of the protein. Molecular dynamics simulations can further refine these models by simulating the behavior of the enzyme in a lipid bilayer environment over time. When performing these computational analyses, researchers should validate their models against experimental mutagenesis data, particularly focusing on the critical residues identified in the active site .

How can site-directed mutagenesis be optimally designed to investigate UppP catalytic mechanisms?

Site-directed mutagenesis studies should target the highly conserved residues in the consensus regions of UppP. Previous research has shown that mutations E17A/E21A, H30A, S173A, R174A, and T178A result in complete inactivation of the enzyme. When designing mutagenesis experiments, researchers should consider:

  • Sequential mutation of individual residues within the (E/Q)XXXE motif to determine the contribution of each glutamate/glutamine

  • Conservative substitutions (e.g., E→D or H→K) to test the importance of specific chemical properties

  • Investigation of the conserved histidine (H30) that is spatially proximate to the pyrophosphate moiety

  • Mutation of residues in the PGXSRSXXT motif, particularly R174 which may establish hydrogen bonds with the hydroxyl group of the pyrophosphate moiety

  • Introduction of mutations that alter metal ion coordination to investigate cofactor requirements

Each mutant should be tested for both in vitro phosphatase activity and in vivo complementation of UppP-deficient strains to comprehensively characterize the functional impact .

How does UppP function integrate with bacterial stress response pathways?

Recent research in Bacillus subtilis has shown that UppP function is integrated with bacterial stress response pathways, particularly through the SigM stress-response sigma factor. When levels of free undecaprenyl-phosphate (UndP) are low, SigM activates genes that increase flux through the essential cell wall synthesis pathway, promote recycling of the lipid carrier, and liberate the carrier from other polymer pathways. Two additional enzymes under SigM control, UshA and UpsH, help maintain the free pool of UndP. UshA liberates UndP from undecaprenyl-monophosphate-linked sugars, while UpsH releases UndP from undecaprenyl-diphosphate-linked wall teichoic acids polymers. These findings suggest that UppP function is part of a comprehensive stress-response system that maintains the UndP pool and prioritizes its use for peptidoglycan synthesis under challenging conditions .

What are the implications of UppP research for understanding antibiotic resistance mechanisms?

Understanding UppP function has significant implications for antibiotic research, particularly regarding glycopeptide antibiotics like vancomycin that bind lipid-linked precursors used in extracytoplasmic polymer synthesis. These antibiotics deplete the universal carrier lipid undecaprenyl-phosphate, affecting the synthesis of virtually all surface polymers, including peptidoglycan. By understanding how cells respond to this stress through UppP and related enzymes, researchers can identify potential targets for new antimicrobial compounds.

UppP is also known as Bacitracin resistance protein, highlighting its role in resistance to this specific antibiotic. Bacitracin works by binding to undecaprenyl pyrophosphate, preventing its dephosphorylation and recycling. By investigating the structural and functional aspects of UppP, researchers can develop strategies to overcome bacitracin resistance or design new antibiotics that target this critical pathway in bacterial cell wall synthesis .

How does environmental salinity affect UppP expression and function in S. ruber?

S. ruber is a halophilic organism found in hypersaline environments with salt concentrations up to 25%. The expression and function of UppP in S. ruber are likely adapted to these extreme conditions. Studies on the genomic diversity of S. ruber strains isolated from Mediterranean solar salterns have shown that genes involved in environmental interactions and adaptation to extremophilic conditions, potentially including uppP, are differentially impacted by genetic exchange processes.

Research on S. ruber strains collected from manipulated environments with varying salinity levels (through dilution with freshwater) suggests that the expression of membrane proteins, including those involved in cell wall synthesis like UppP, may vary in response to salinity stress. When investigating UppP function in S. ruber, researchers should consider the native high-salt environment and how changes in salinity might affect enzyme expression, stability, and activity. Comparative studies of UppP from S. ruber with homologs from non-halophilic bacteria could provide insights into adaptations that allow the enzyme to function optimally in high-salt conditions .

What methodologies are most effective for studying UppP in the context of complex membrane environments?

Studying UppP in complex membrane environments presents unique challenges due to its integral membrane nature. Effective methodologies include:

  • Native membrane nanodisc technology: This approach involves reconstituting UppP into nanodiscs with native or synthetic lipids, allowing for the study of enzyme function in a more physiologically relevant context.

  • Fluorescence-based assays: Using fluorescently labeled substrates or products to monitor UppP activity in real-time within membrane environments.

  • Cryo-electron microscopy: This technique can provide structural insights into UppP in its native membrane environment, potentially capturing different conformational states during catalysis.

  • Solid-state NMR spectroscopy: Useful for studying the dynamics and interactions of UppP within lipid bilayers.

  • Single-molecule tracking: This approach can provide insights into the spatial distribution and dynamics of UppP in bacterial membranes.

These methodologies should be adapted to account for the halophilic nature of S. ruber, potentially including high salt concentrations in buffers and experimental conditions .

How might comparative genomics approaches inform our understanding of UppP evolutionary adaptations?

Comparative genomics approaches can provide valuable insights into the evolutionary adaptations of UppP across different bacterial species, particularly in extremophiles like S. ruber. S. ruber exhibits an open pangenome with contrasting evolutionary patterns in the core and accessory genomes. The core genome, which includes essential genes like uppP, is shaped by extensive homologous recombination, while the accessory genome is modulated by horizontal gene transfer.

By comparing uppP sequences from multiple S. ruber strains isolated from different hypersaline environments, researchers can identify conserved regions critical for function versus variable regions that might represent adaptations to specific environmental conditions. This comparative approach can also help identify residues under positive selection, suggesting their importance in adaptive processes. Additionally, comparing uppP from S. ruber with homologs from diverse bacterial phyla can reveal evolutionary patterns and functional constraints across the bacterial domain .

What are the potential applications of UppP research in developing novel antimicrobial strategies?

UppP research has significant potential for developing novel antimicrobial strategies due to its critical role in bacterial cell wall synthesis. Several promising research directions include:

  • Structure-based drug design: Using the proposed active site of UppP, featuring (E/Q)XXXE and PGXSRSXXT motifs and a histidine residue, researchers can design specific inhibitors that target this essential enzyme.

  • Combination therapies: Understanding how cells respond to carrier lipid depletion through stress-response pathways can inform strategies for combining existing antibiotics with modulators of these pathways.

  • Extremophile-derived antimicrobials: Insights from S. ruber UppP may reveal unique structural or functional adaptations that could inform the development of antimicrobials effective under extreme conditions.

  • Carrier lipid competition: Exploiting the competition between essential peptidoglycan synthesis and other cell surface polymer pathways for the limited pool of undecaprenyl phosphate.

  • Biofilm disruptors: Since cell wall synthesis is critical for biofilm formation, UppP inhibitors might serve as biofilm disruptors in combination with conventional antibiotics.

Recent findings that two additional enzymes (UshA and UpsH) work in concert with UppP to maintain the undecaprenyl phosphate pool suggest that targeting multiple enzymes in this pathway simultaneously might be particularly effective in preventing bacterial adaptation and resistance development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.