Recombinant Salinispora arenicola NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in Complex I

nuoK is part of the peripheral subcomplex of Complex I, which facilitates electron transfer from NADH to ubiquinone. While its exact role remains understudied, subunit K in other organisms (e.g., E. coli) contributes to structural stability and redox coupling. The recombinant protein retains critical residues for potential interactions with other subunits or cofactors.

Expression and Refolding

ParameterDetailsSource
Host OrganismE. coli
Expression SystemBacterial recombinant protein production
ReconstitutionRecommended in deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0

Stability and Handling

  • Storage: -20°C/-80°C for long-term storage; avoid repeated freeze-thaw cycles.

  • Working Aliquots: Store at 4°C for up to one week.

Potential Uses of Recombinant nuoK

ApplicationDetailsSource
Structural StudiesX-ray crystallography or NMR to resolve interactions with other subunits.
Enzyme Activity AssaysTesting electron transfer efficiency in reconstituted systems.
ImmunoassaysELISA for detecting nuoK in bacterial lysates or environmental samples.
Comparative GenomicsPhylogenetic analysis of Complex I subunits across marine actinobacteria.

Salinispora Species and BGCs

  • S. arenicola is a marine actinobacterium noted for harboring cryptic biosynthetic gene clusters (BGCs), including nonribosomal peptide synthetases (NRPS) and polyketide synthases (PKS) .

  • While nuoK is not directly linked to secondary metabolism, its presence in S. arenicola highlights the species’ genetic diversity, which may underpin its adaptation to saline environments .

Research Gaps and Future Directions

  1. Functional Characterization:

    • Limited studies directly address nuoK’s role in electron transport. Comparative studies with homologs (e.g., S. tropica, S. pacifica) could elucidate species-specific adaptations .

  2. Structural Insights:

    • Crystallographic data for nuoK are absent. Structural analysis could reveal interactions with ubiquinone or other subunits.

  3. Ecological Relevance:

    • The symbiotic potential of S. arenicola in plant-microbe interactions (e.g., salt stress alleviation) may involve Complex I activity, warranting further investigation.

References

  1. Creative Biomart. Recombinant Full Length Salinispora arenicola NADH-quinone oxidoreductase subunit K(nuoK) Protein, His-Tagged. [Online].

  2. Ocampo-Alvarez et al. (2022). Habitat-adapted heterologous symbiont Salinispora arenicola promotes growth and alleviates salt stress in tomato crop plants. PMC.

  3. Xia et al. (2012). Adenylation Domain in Marine Actinomycete Salinispora arenicola CNS-205. CiteSeerX.

  4. MyBioSource. Recombinant Salinispora arenicola NADH-quinone oxidoreductase subunit K (nuoK). [Online].

  5. American Science. ELISA Recombinant Salinispora arenicola NADH-quinone oxidoreductase subunit K(nuoK). [Online].

  6. Jensen et al. (2017). Genomic Insights into Specialized Metabolism in the Marine Actinomycete Genus Salinispora. PMC.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
nuoK; Sare_4453; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Salinispora arenicola (strain CNS-205)
Target Names
nuoK
Target Protein Sequence
MNDFFSVEPNYYLVLAAVLFTIGAAGVLVRRNAIVLFMCVELMLNAANLTLVTFSRINGD LNGQIIAFFVMVVAAAEVVVGLAIIMAIFRTRRSASVDDANLLKY
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this organism, the primary electron acceptor is believed to be a menaquinone. The enzyme couples this redox reaction to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, conserving redox energy in a proton gradient.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its role in Salinispora arenicola?

NADH-quinone oxidoreductase subunit K (nuoK) is a small membrane protein component of the bacterial NADH-quinone oxidoreductase (NDH-1) complex, which is homologous to Complex I in mitochondria . In Salinispora arenicola, nuoK functions as part of the electron transport chain involved in energy metabolism. The nuoK subunit is the bacterial homologue of the mitochondrial ND4L subunit, which is the smallest mitochondrial DNA-encoded subunit of the proton-translocating NADH-quinone oxidoreductase . This subunit plays a critical role in the coupling mechanism that links electron transfer to proton translocation across the membrane, which is essential for energy generation in the bacteria.

How should recombinant Salinispora arenicola nuoK protein be stored and handled for optimal stability?

The recombinant nuoK protein is typically supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt . For optimal stability and activity, the following storage and handling protocols are recommended:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) and aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they may compromise protein integrity

  • Working aliquots can be stored at 4°C for up to one week

What expression systems are used for production of recombinant Salinispora arenicola nuoK?

Recombinant Salinispora arenicola nuoK protein is typically expressed in E. coli expression systems . The protein is usually produced with an N-terminal His-tag to facilitate purification through affinity chromatography. The full-length protein (amino acids 1-105) can be successfully expressed in E. coli, although membrane proteins often present challenges for heterologous expression. The optimization of expression conditions, including temperature, induction parameters, and host strain selection, may be necessary to achieve adequate yields of properly folded protein.

How do mutations in conserved residues of nuoK affect the function of NADH-quinone oxidoreductase complex?

Studies on the E. coli homologue of nuoK have shown that mutations of conserved residues have significant impacts on the function of the NADH-quinone oxidoreductase complex. Specifically:

  • Mutations of the nearly perfectly conserved Glu-36 lead to almost complete loss of coupled electron transfer activity and generation of electrochemical gradient

  • Mutations of another highly conserved residue, Glu-72, result in significant diminution of coupled activities

  • Severe impairment of coupled activities occurs when two vicinal arginine residues on a cytosolic loop are simultaneously mutated

These findings suggest that the membrane-embedded acidic residues (Glu-36 and Glu-72) are critical for the coupling mechanism of NDH-1, while the arginine residues on the cytosolic loop may play roles in substrate binding, protein-protein interactions, or maintaining proper protein conformation . Similar studies could be conducted with Salinispora arenicola nuoK to determine if these conserved residues have comparable functions across bacterial species.

What methodologies can be used to study the membrane topology and protein-protein interactions of nuoK in the NADH-quinone oxidoreductase complex?

To investigate the membrane topology and protein-protein interactions of nuoK, several complementary methodologies can be employed:

  • Site-directed mutagenesis: Systematically mutate conserved residues and analyze the effects on complex assembly and function, as done in previous studies with E. coli nuoK

  • Blue-native gel electrophoresis: This technique can be used to assess whether mutations affect the assembly of the full complex, as demonstrated in studies where all point mutants examined had fully assembled NDH-1

  • Immunostaining: Combined with blue-native gel electrophoresis, this can confirm the presence of specific subunits within the complex

  • Activity assays: Measure coupled electron transfer activities and generation of electrochemical gradient to assess functional consequences of mutations

  • Cross-linking studies: Identify neighboring subunits and characterize direct protein-protein interactions within the complex

  • Cryo-electron microscopy: Determine the structure of the entire complex, allowing visualization of nuoK in its native context within the assembled complex

How does the environmental context of Salinispora arenicola influence the structure and function of nuoK?

Salinispora arenicola is a marine bacterium found in tropical and temperate Pacific Ocean sediments, and its adaptation to this environment may influence the structure and function of its proteins, including nuoK . The high salinity of the marine environment might affect:

  • Membrane composition and properties, which could influence how nuoK is anchored and functions within the membrane

  • Ion gradients across the membrane, potentially affecting the proton-pumping activity of the NADH-quinone oxidoreductase complex

  • Evolutionary adaptations in the protein sequence to maintain stability and function under marine conditions

Comparative studies between nuoK from marine bacteria like Salinispora arenicola and terrestrial bacteria could reveal adaptations specific to the marine environment. Additionally, investigating the effects of different salt concentrations on the activity and stability of recombinant nuoK would provide insights into its environmental adaptations.

What is the relationship between nuoK function and the biosynthetic capabilities of Salinispora arenicola?

Salinispora arenicola is described as "biosynthetically talented," producing various natural products including salinorcinol, salinacetamide, and salinisporamine . The relationship between energy metabolism (involving nuoK) and secondary metabolite production could be explored through:

  • Metabolic flux analysis: Investigate how electron transport chain activity influences precursor availability for natural product biosynthesis

  • Gene knockout studies: Determine if partial inhibition of NADH-quinone oxidoreductase activity affects the production of specific natural products

  • Comparative genomics: Analyze the genomic context of nuoK across different Salinispora strains to identify potential regulatory connections with biosynthetic gene clusters

  • Transcriptomic studies: Examine co-expression patterns between nuoK and biosynthetic gene clusters under various growth conditions

Such studies would help understand how primary metabolism, including electron transport chain components like nuoK, supports the extensive secondary metabolism capabilities of Salinispora arenicola.

How can I design site-directed mutagenesis experiments to study the functional roles of conserved residues in Salinispora arenicola nuoK?

Based on previous studies with E. coli nuoK, a systematic approach to site-directed mutagenesis can be designed for Salinispora arenicola nuoK:

  • Target selection:

    • Focus on highly conserved glutamic acid residues that are likely membrane-embedded (homologous to E. coli Glu-36 and Glu-72)

    • Target arginine residues predicted to be on cytosolic loops

    • Consider conserved residues at predicted protein-protein interaction interfaces

  • Mutation strategy:

    • Conservative substitutions (e.g., Glu to Asp, Arg to Lys) to test the importance of specific chemical properties

    • Non-conservative substitutions (e.g., Glu to Ala, Arg to Ala) to completely remove the functional group

    • When testing pairs of residues, create both single and double mutants to assess potential synergistic effects, as seen with the arginine residues in E. coli nuoK

  • Expression system:

    • Use homologous recombination techniques to introduce mutations directly into the genome to maintain native regulation

    • Alternatively, express wild-type and mutant proteins in a heterologous system for biochemical characterization

  • Functional assays:

    • Measure NADH dehydrogenase activity

    • Assess coupled electron transfer activity

    • Measure generation of electrochemical gradient using membrane potential-sensitive dyes

    • Compare each mutant's activity to wild-type protein to quantify functional impact

What purification protocol would yield the highest purity and activity of recombinant Salinispora arenicola nuoK for structural studies?

A comprehensive purification protocol for obtaining high-purity, active recombinant Salinispora arenicola nuoK would include:

  • Expression optimization:

    • Test multiple E. coli strains specialized for membrane protein expression

    • Optimize induction conditions (temperature, IPTG concentration, induction time)

    • Consider using auto-induction media for gentle, gradual protein expression

  • Cell lysis and membrane isolation:

    • Use gentle lysis methods to preserve protein structure

    • Isolate membrane fractions through differential centrifugation

    • Extract membrane proteins using appropriate detergents (trial multiple options like DDM, LMNG, or GDN)

  • Affinity purification:

    • Utilize the N-terminal His-tag for immobilized metal affinity chromatography (IMAC)

    • Include detergent in all buffers to maintain protein solubility

    • Consider using gradient elution to improve purity

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and isolate uniformly folded protein

    • Ion exchange chromatography as an additional purification step if necessary

  • Quality control:

    • Assess purity by SDS-PAGE (should exceed 90%)

    • Verify protein identity by Western blot and/or mass spectrometry

    • Evaluate protein folding using circular dichroism spectroscopy

    • Test functional activity if possible

  • Storage:

    • Store in buffer containing appropriate detergent and potentially glycerol

    • Flash-freeze in liquid nitrogen and store at -80°C

    • Alternatively, maintain at 4°C for short-term studies to avoid freeze-thaw damage

What techniques can be used to reconstitute purified nuoK into proteoliposomes for functional studies?

Reconstitution of purified Salinispora arenicola nuoK into proteoliposomes provides a controlled environment for functional studies. A methodological approach would include:

  • Liposome preparation:

    • Select lipid composition mimicking bacterial membranes or use extracted Salinispora arenicola lipids for native-like environment

    • Prepare unilamellar vesicles by extrusion through polycarbonate filters

    • Control vesicle size (typically 100-200 nm diameter) for optimal experimental conditions

  • Protein incorporation:

    • Direct incorporation: Mix detergent-solubilized nuoK with preformed liposomes and remove detergent using Bio-Beads or dialysis

    • Co-micellization: Co-solubilize lipids and protein in detergent, then remove detergent to form proteoliposomes

    • Monitor incorporation efficiency using fluorescently-labeled protein or antibody-based detection

  • Functional validation:

    • Assess protein orientation in the membrane using protease protection assays

    • Measure proton pumping activity using pH-sensitive fluorescent dyes

    • Assess electron transfer activity with appropriate substrates and electron acceptors

  • Advanced applications:

    • Co-reconstitute with other subunits of the NADH-quinone oxidoreductase complex to study multi-protein interactions

    • Introduce site-specific probes at key residues to monitor conformational changes during catalysis

    • Manipulate lipid composition to study the influence of membrane environment on nuoK function

How can discrepancies between in vitro and in vivo studies of nuoK function be reconciled?

Researchers often encounter discrepancies between results obtained from in vitro studies with purified recombinant nuoK and in vivo studies in native Salinispora arenicola. These discrepancies can be addressed through:

  • Systematic comparison:

    • Create a table comparing specific functional parameters measured in both systems

    • Identify patterns in the differences (e.g., consistently lower/higher activity in one system)

  • Environmental factors:

    • Analyze the influence of the lipid environment (native membranes vs. artificial liposomes)

    • Test the effect of ionic conditions, especially considering the marine origin of Salinispora arenicola

    • Evaluate the impact of cellular crowding agents on in vitro studies

  • Protein modifications:

    • Investigate if post-translational modifications present in vivo are absent in recombinant protein

    • Assess if the His-tag affects protein function or interactions

    • Consider if protein folding differs between expression systems

  • Interaction partners:

    • Identify if accessory proteins present in vivo but absent in vitro affect function

    • Test if full complex assembly is required for proper function of nuoK

  • Bridging approaches:

    • Use complementation studies, where recombinant protein is expressed in nuoK-deficient strains

    • Perform in-cell structural studies such as in-cell NMR or FRET to bridge the in vitro-in vivo gap

What statistical approaches are most appropriate for analyzing the effects of nuoK mutations on NADH-quinone oxidoreductase activity?

When analyzing the effects of nuoK mutations on enzyme activity, robust statistical approaches are essential:

How can researchers distinguish between direct effects of nuoK mutations on catalysis versus indirect effects on protein stability or complex assembly?

Distinguishing direct catalytic effects from indirect structural effects of mutations requires a multi-faceted approach:

  • Protein stability analysis:

    • Thermal shift assays to compare melting temperatures of wild-type and mutant proteins

    • Circular dichroism to assess secondary structure integrity

    • Limited proteolysis to evaluate conformational changes

    • In silico prediction of mutation effects on protein stability

  • Complex assembly assessment:

    • Blue-native gel electrophoresis followed by immunostaining to visualize intact complexes

    • Size exclusion chromatography to analyze complex formation

    • Co-immunoprecipitation to assess protein-protein interactions

    • Quantitative analysis of subunit stoichiometry in purified complexes

  • Kinetic analysis:

    • Detailed enzyme kinetics to distinguish effects on KM versus kcat

    • Measure activities under varying substrate concentrations

    • Analyze the temperature dependence of activity (Arrhenius plots) to identify changes in activation energy

  • Correlation analysis:

    • Plot stability parameters against activity measurements to identify relationships

    • Analyze whether activity loss correlates with assembly defects

    • Create a decision matrix to categorize mutations based on their effects

  • Direct structural assessment:

    • Hydrogen-deuterium exchange mass spectrometry to detect conformational changes

    • Fluorescence resonance energy transfer (FRET) to measure distances between key residues

    • Computational modeling to predict structural perturbations

How might comparative studies of nuoK across different Salinispora species enhance our understanding of its evolution and function?

Salinispora occurs in multiple species, including S. arenicola, S. tropica, and S. pacifica, providing an opportunity for evolutionary and functional comparative studies of nuoK:

  • Sequence comparison:

    • Align nuoK sequences from different Salinispora species to identify conserved and variable regions

    • Map conservation onto predicted structural models to identify functionally critical domains

    • Analyze selection pressures across different parts of the protein

  • Habitat correlation:

    • Compare nuoK sequences from strains isolated from different marine environments (tropical vs. temperate)

    • Correlate sequence variations with specific environmental parameters (temperature, depth, salinity)

    • Test if nuoK from different environments shows distinct functional characteristics

  • Experimental approaches:

    • Express and characterize nuoK from multiple Salinispora species under identical conditions

    • Perform domain swapping experiments to identify regions responsible for species-specific characteristics

    • Use reciprocal complementation studies to test functional conservation in vivo

  • Integration with genomic data:

    • Correlate nuoK variations with differences in metabolic capabilities across species

    • Analyze the genomic context of nuoK across species to identify potential co-evolved genes

    • Examine if nuoK variation correlates with differences in natural product biosynthetic gene clusters

What role might nuoK play in the adaptation of Salinispora arenicola to specific marine environments?

Salinispora arenicola is found in marine sediments across different oceanic regions, suggesting potential adaptation of its energy metabolism to specific environmental conditions:

  • Environmental adaptations:

    • Analyze if nuoK from strains isolated from different depths shows adaptations related to oxygen availability

    • Investigate temperature-dependent activity profiles of nuoK from tropical versus temperate strains

    • Test the salt dependence of nuoK function, considering the marine habitat of Salinispora arenicola

  • Energy metabolism flexibility:

    • Investigate if nuoK function changes under different growth conditions

    • Examine if alternative electron transport pathways exist that might complement or replace nuoK function

    • Study how nuoK expression and activity respond to environmental stressors

  • Methodological approaches:

    • Isolation and characterization of nuoK from Salinispora strains across geographical gradients

    • Laboratory evolution experiments under different environmental conditions

    • Heterologous expression of nuoK variants in model bacteria exposed to various stressors

  • Integration with ecological data:

    • Correlate nuoK sequence variations with specific ecological niches

    • Examine co-occurrence patterns with other microorganisms in natural habitats

    • Investigate if nuoK function influences competitive fitness in different marine niches

How can structural data on nuoK be integrated with functional studies to guide rational protein engineering?

Integrating structural insights with functional data provides powerful opportunities for rational engineering of nuoK properties:

  • Structure prediction and modeling:

    • Generate high-quality structural models using AlphaFold2 or similar tools

    • Perform molecular dynamics simulations to understand protein dynamics

    • Identify potential proton translocation pathways within the protein structure

  • Structure-guided mutagenesis:

    • Target residues at predicted functional sites based on structural information

    • Design mutations to modify specific properties (stability, activity, substrate specificity)

    • Create chimeric proteins by swapping domains between homologous proteins

  • Advanced biophysical characterization:

    • Use site-specific spectroscopic probes to monitor conformational changes during catalysis

    • Perform EPR spectroscopy to investigate electron transfer pathways

    • Apply time-resolved methods to capture transient states during catalysis

  • Integration with complex-level data:

    • Map nuoK position and interactions within the larger NADH-quinone oxidoreductase complex

    • Identify interface residues that could be modified to alter complex assembly or stability

    • Design mutations that might enhance coupling efficiency between electron transfer and proton pumping

  • Applications of engineered variants:

    • Develop nuoK variants with enhanced stability for biotechnological applications

    • Engineer variants with altered energy coupling efficiencies

    • Create reporter systems based on nuoK for studying membrane bioenergetics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.