Recombinant Salinispora tropica ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

Salinispora tropica is a marine actinomycete known for producing structurally diverse and biologically active secondary metabolites . Recombinant Salinispora tropica ATP synthase subunit b (atpF) is a transmembrane protein that is a subunit of the ATP synthase complex in Salinispora tropica . ATP synthase, or F1F0-ATPase, produces ATP from ADP using a proton or sodium gradient . It consists of two structural domains: F1, which contains the extramembraneous catalytic core, and F0, which contains the membrane proton channel, linked by a central and peripheral stalk .

Characteristics

CharacteristicDescription
Product CodeCSB-CF002358STD
UniProt No.A4XAW6
Product TypeTransmembrane Protein
Immunogen SpeciesSalinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440)
SequenceMFLAAEGSHNPILPIWQELVVGTIAFALLVFVLLKFVMPRMETMYQARVDAIEGGLKRAEAAQAEANQLLEQYRAQLAEVRTEAARIRDDARADAEGIRQDILAKAREESDRIIAAGKEQLVAERTTIVRELRTEVGTLAVDLAGKIVGESLADEARRAGTVDRFLNGLESAGAR
Sourcein vitro E. coli expression system
Target NamesatpF
Protein NamesATP synthase subunit b, ATP synthase F(0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
Expression Region1-175
Tag InfoN-terminal 10xHis-tagged
Protein LengthFull length protein

Function and Structure

ATP synthase subunit b (atpF) is a component of the F0 sector of the ATP synthase complex, which is embedded in the cell membrane . The F0 sector acts as a proton channel, allowing protons to flow across the membrane down their electrochemical gradient . This flow of protons drives the rotation of the F0 sector, which in turn drives the synthesis of ATP in the F1 sector . The subunit b protein is essential for the proper assembly and function of the ATP synthase complex .

Research and Applications

Salinispora tropica is explored as a heterologous host for expressing biosynthetic gene clusters (BGCs) . S. tropica CNB-440 was engineered to create an integratable host with a clean background of secondary metabolism by replacing three genes (salA–C) essential for salinosporamide biosynthesis with a cassette containing the Streptomyces coelicolor ΦC31 phage attachment site attB . This resulted in the mutant S. tropica CNB-4401 via double-crossover recombination, which simplifies the strain’s chemical background by abolishing the production of salinosporamides .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Strop_3634; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440)
Target Names
atpF
Target Protein Sequence
MFLAAEGSHNPILPIWQELVVGTIAFALLVFVLLKFVMPRMETMYQARVDAIEGGLKRAE AAQAEANQLLEQYRAQLAEVRTEAARIRDDARADAEGIRQDILAKAREESDRIIAAGKEQ LVAERTTIVRELRTEVGTLAVDLAGKIVGESLADEARRAGTVDRFLNGLESAGAR
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases comprise two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Salinispora tropica ATP synthase subunit b (atpF) and what role does it play in cellular energy metabolism?

ATP synthase subunit b (atpF) in Salinispora tropica is a critical component of the F-type ATPase complex, playing an essential structural and functional role in cellular ATP synthesis. This protein forms part of the F₀ sector, which spans the membrane and works in conjunction with the F₁ sector to catalyze ATP formation through a rotary mechanism driven by proton motive force.

The protein is encoded by the atpF gene (locus tag: Strop_3634) in the S. tropica genome and consists of 175 amino acids in its full-length form . As a marine actinomycete, S. tropica's ATP synthase has evolved to function efficiently in saline environments, which likely impacts structural stability and enzymatic functionality of the complex. Understanding this protein contributes to broader knowledge of energy metabolism adaptations in marine microorganisms.

What are the recommended laboratory protocols for storage and handling of recombinant S. tropica ATP synthase subunit b?

For optimal stability and activity of recombinant S. tropica ATP synthase subunit b, the following storage and handling protocols are recommended:

  • Storage conditions:

    • Store protein at -20°C for standard use

    • For extended storage periods, maintain at -80°C to prevent degradation

    • Use a storage buffer consisting of Tris-based buffer with 50% glycerol, specifically optimized for this protein

  • Handling recommendations:

    • Avoid repeated freeze-thaw cycles as they significantly compromise protein integrity

    • When actively working with the protein, maintain working aliquots at 4°C for up to one week

    • After thawing, keep the protein on ice during experimental procedures

  • Quality control measures:

    • Verify protein integrity via SDS-PAGE before experimental use

    • Confirm functional activity through ATP hydrolysis assays when applicable

    • Monitor pH stability, as marine-derived proteins often have distinct pH optima compared to terrestrial homologs

Following these protocols ensures maximum retention of structural integrity and functional activity throughout experimental procedures.

What expression systems are most effective for producing recombinant S. tropica ATP synthase subunit b?

Based on research with Salinispora species, several expression systems have demonstrated effectiveness for recombinant protein production, each with distinct advantages for ATP synthase subunit b expression:

Expression SystemAdvantagesConsiderationsYield Potential
Engineered S. tropica CNB-4401Native post-translational processing; superior codon usage compatibilitySlower growth than E. coli; requires marine mediaMedium-High (≈3× higher than S. coelicolor)
E. coli BL21(DE3)Rapid growth; well-established protocolsMay require codon optimization; lacks marine-specific chaperonesMedium
S. coelicolor M1152Compatible ΦC31 phage attachment site; actinomycete-specific folding machineryLower expression than S. tropica for some proteinsMedium

For membrane proteins like ATP synthase subunit b, the engineered S. tropica CNB-4401 strain offers significant advantages. This strain was developed with the ΦC31 phage attachment site (attB) introduced into its genome, enabling stable integration of expression constructs while simultaneously eliminating background salinosporamide production . When expressing heterologous biosynthetic gene clusters, S. tropica CNB-4401 demonstrated approximately 3-fold higher production compared to the established S. coelicolor M1152 host .

How can researchers optimize heterologous expression of S. tropica ATP synthase subunit b?

Optimizing heterologous expression of S. tropica ATP synthase subunit b requires careful consideration of several factors:

  • Vector design:

    • Incorporate the ΦC31 integrase system for stable genomic integration in actinomycete hosts

    • Use vectors compatible with the introduced attB site in engineered S. tropica CNB-4401

    • Select appropriate promoters (ermE* for constitutive expression or inducible systems for controlled expression)

  • Host selection:

    • S. tropica CNB-4401 offers superior expression for actinomycete proteins (≈3-fold higher than S. coelicolor M1152)

    • Consider the engineered host's simplified metabolic background, which enhances precursor availability

  • Culture optimization:

    • Marine salt concentration (approximately 3% NaCl) improves expression in Salinispora-based systems

    • Temperature modulation (typically 28-30°C for Salinispora) affects membrane protein folding

    • Carbon source selection impacts expression levels (glucose vs. complex carbon sources)

  • Protein extraction protocol:

    • For membrane proteins like ATP synthase subunit b, gentle detergent-based extraction methods preserve structure

    • Two-phase extraction systems can improve yield while maintaining native conformation

Implementation of these optimization strategies has demonstrated significant improvements in both yield and functional activity of membrane proteins from marine actinomycetes.

What methodological approaches are most effective for purifying recombinant S. tropica ATP synthase subunit b?

Purification of recombinant S. tropica ATP synthase subunit b requires specialized approaches to address its membrane-associated nature:

  • Initial membrane preparation:

    • Harvest cells during late logarithmic phase for optimal expression

    • Lyse cells via sonication or French press in buffer containing protease inhibitors

    • Separate membrane fraction through ultracentrifugation (typically 100,000 × g for 1 hour)

  • Solubilization strategy:

    • Test multiple detergents for optimal solubilization (n-dodecyl-β-D-maltoside, digitonin, or Triton X-100)

    • Solubilize at 4°C with gentle agitation for 1-2 hours

    • Remove insoluble material via centrifugation (20,000 × g for 30 minutes)

  • Chromatographic purification sequence:

    • Immobilized metal affinity chromatography (IMAC) as initial capture step if histidine-tagged

    • Ion exchange chromatography to exploit the charged nature of ATP synthase subunit b

    • Size exclusion chromatography as a final polishing step

  • Quality assessment:

    • SDS-PAGE analysis to confirm purity

    • Western blot verification with anti-ATP synthase subunit b antibodies

    • Circular dichroism spectroscopy to verify proper secondary structure formation

This methodological approach yields highly purified, functionally active protein suitable for structural and biochemical characterization studies.

What experimental designs are appropriate for studying the interaction of S. tropica ATP synthase subunit b with other ATP synthase components?

Investigating interactions between S. tropica ATP synthase subunit b and other ATP synthase components requires multifaceted experimental approaches:

  • In vitro reconstitution studies:

    • Co-expression of multiple ATP synthase subunits in engineered S. tropica CNB-4401

    • Sequential addition of purified components to assess binding order and stoichiometry

    • Liposome reconstitution to analyze function in a membrane environment

  • Protein-protein interaction methods:

    • Pull-down assays using tagged ATP synthase subunit b as bait

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization

  • Structural analysis approaches:

    • Cross-linking mass spectrometry (XL-MS) to identify interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes

    • Cryo-electron microscopy of reconstituted complexes

  • Functional assays:

    • ATP synthesis/hydrolysis measurements of reconstituted complexes

    • Proton pumping assays using pH-sensitive fluorescent dyes

    • Rotational measurements using single-molecule techniques

These complementary approaches provide comprehensive insights into both structural and functional aspects of subunit interactions within the ATP synthase complex.

How can researchers study the impact of environmental factors on S. tropica ATP synthase subunit b function?

As a marine actinomycete, S. tropica has evolved to function in specific environmental conditions. Researching how these conditions affect ATP synthase subunit b requires specialized experimental designs:

  • Salt concentration effects:

    • Measure ATP synthase activity across a range of NaCl concentrations (0-10%)

    • Analyze structural stability using circular dichroism spectroscopy at varying salt concentrations

    • Determine ion-specific effects by substituting different salts (KCl, MgCl₂)

  • Temperature adaptation studies:

    • Compare activity profiles of S. tropica ATP synthase with terrestrial homologs across temperature ranges

    • Analyze thermal stability using differential scanning calorimetry

    • Measure activation energy parameters through Arrhenius plots

  • pH response characterization:

    • Establish pH-activity profiles (typically pH 4-10)

    • Monitor conformational changes at different pH values using intrinsic fluorescence

    • Determine pH-dependent protein-protein interaction strength

  • Pressure effects (relevant to marine depth adaptation):

    • Utilize specialized high-pressure chambers to measure activity under pressure

    • Analyze pressure-induced conformational changes through spectroscopic methods

    • Compare pressure stability with ATP synthases from surface-dwelling organisms

These methodological approaches provide insights into the unique adaptations of S. tropica ATP synthase to marine environments, with potential applications in biotechnology and understanding microbial adaptations.

What genetic engineering approaches can be used to modify S. tropica ATP synthase subunit b for structure-function studies?

Strategic genetic modifications of S. tropica ATP synthase subunit b can yield valuable insights into structure-function relationships:

  • Site-directed mutagenesis strategy:

    • Target conserved residues identified through sequence alignment with other bacterial ATP synthases

    • Create alanine-scanning libraries across specific domains

    • Design mutations at the membrane-cytoplasm interface to probe topological importance

  • Domain swapping methodology:

    • Replace domains with corresponding regions from terrestrial actinomycetes

    • Create chimeric proteins with domains from other Salinispora species

    • Engineer fusion constructs to probe membrane insertion and topology

  • Implementation in S. tropica expression system:

    • Utilize the engineered S. tropica CNB-4401 strain containing the ΦC31 phage attachment site (attB)

    • Employ double-crossover recombination for stable genome integration

    • Verify mutant expression using the established heterologous expression platform

  • Functional assessment approaches:

    • Measure ATP synthesis/hydrolysis activity of mutant proteins

    • Analyze oligomerization capacity through size exclusion chromatography

    • Determine structural stability using thermal shift assays

The engineered S. tropica CNB-4401 strain provides an ideal platform for these studies, as it offers a clean background free of salinosporamides while maintaining the native cellular environment for proper protein folding and assembly .

How should researchers troubleshoot expression issues with recombinant S. tropica ATP synthase subunit b?

When facing challenges with recombinant expression of S. tropica ATP synthase subunit b, a systematic troubleshooting approach is recommended:

  • Low expression yield troubleshooting:

    • Optimize codon usage for the selected expression host

    • Adjust induction conditions (temperature, inducer concentration, induction timing)

    • Consider alternative promoters (e.g., ermE* vs. tipA)

    • Test different S. tropica-compatible expression vectors utilizing the ΦC31 integrase system

  • Protein solubility issues resolution:

    • Express as fusion protein with solubility-enhancing tags (MBP, SUMO)

    • Adjust cell lysis conditions (detergent selection, buffer composition)

    • Lower expression temperature to reduce aggregation (28°C or 18°C)

    • Co-express with chaperones specific to membrane protein folding

  • Protein stability challenges:

    • Optimize storage buffer composition (typically Tris-based buffer with 50% glycerol)

    • Implement strict temperature control during purification

    • Add stabilizing additives (glycerol, specific lipids, salt concentration adjustment)

    • Minimize freeze-thaw cycles through appropriate aliquoting strategies

  • Functionality issues:

    • Verify correct folding through circular dichroism spectroscopy

    • Assess oligomeric state through size exclusion chromatography

    • Compare activity with native protein extracted from S. tropica

    • Ensure presence of essential lipids or cofactors

These methodological approaches address the specific challenges associated with membrane protein expression from marine actinomycetes.

What analytical techniques are most appropriate for characterizing the structure of S. tropica ATP synthase subunit b?

Comprehensive structural characterization of S. tropica ATP synthase subunit b requires multiple complementary analytical approaches:

Using these methods in combination provides a comprehensive structural understanding of S. tropica ATP synthase subunit b, essential for mechanistic studies and rational protein engineering.

What are the most effective assays for measuring the functional activity of S. tropica ATP synthase subunit b?

  • Oligomerization assays:

    • Analytical ultracentrifugation to determine oligomeric state

    • Chemical cross-linking followed by SDS-PAGE analysis

    • Förster resonance energy transfer (FRET) between labeled subunits

  • Binding interaction measurements:

    • Surface plasmon resonance (SPR) to quantify binding to other ATP synthase subunits

    • Isothermal titration calorimetry (ITC) for thermodynamic binding parameters

    • Microscale thermophoresis for detecting interactions in complex solutions

  • Reconstituted complex activity:

    • ATP synthesis assays using reconstituted proteoliposomes

    • ATP hydrolysis measurements (colorimetric phosphate detection)

    • Proton translocation assays using pH-sensitive fluorescent dyes

  • Functional complementation:

    • Expression in ATP synthase subunit b-deficient bacterial strains

    • Growth rate comparison under conditions requiring oxidative phosphorylation

    • Membrane potential measurements using voltage-sensitive probes

These functional assays provide comprehensive insights into both the structural role of subunit b and its contribution to the catalytic functions of the ATP synthase complex.

How can researchers investigate the evolutionary adaptations of S. tropica ATP synthase subunit b to marine environments?

Investigating the evolutionary adaptations of S. tropica ATP synthase subunit b to marine environments requires comparative approaches:

  • Comparative sequence analysis:

    • Multiple sequence alignment with ATP synthase subunit b from terrestrial actinomycetes

    • Identification of marine-specific sequence motifs

    • Phylogenetic analysis to trace adaptive changes throughout evolution

  • Structural comparison methodology:

    • Homology modeling of S. tropica ATP synthase subunit b and terrestrial homologs

    • Identification of surface charge distribution differences

    • Analysis of hydrophobic core composition variations

  • Functional adaptation assessment:

    • Comparing salt tolerance of ATP synthase activity between marine and terrestrial species

    • Measuring stability under varying pressure conditions

    • Determining temperature-activity profiles across evolutionary diverse homologs

  • Halotolerance mechanism investigation:

    • Site-directed mutagenesis of marine-specific residues

    • Measurement of ion binding using isothermal titration calorimetry

    • Analysis of protein hydration through neutron scattering techniques

These approaches provide insights into the molecular basis of adaptation to marine environments, with potential applications in protein engineering for enhanced stability under extreme conditions.

What strategies can researchers employ to incorporate S. tropica ATP synthase subunit b into synthetic biology applications?

Leveraging S. tropica ATP synthase subunit b for synthetic biology applications involves several strategic approaches:

  • Engineered energy systems:

    • Design of minimal ATP synthase complexes with optimized efficiency

    • Development of hybrid complexes incorporating subunits from multiple species

    • Creation of light-responsive ATP synthase variants for optogenetic control

  • Biosensor development:

    • Engineering conformational changes in subunit b to report on membrane potential

    • Creation of FRET-based sensors using labeled subunit b

    • Development of ATP production reporters linked to subunit b conformation

  • Nanodevice incorporation:

    • Utilization of the rotary mechanism for nanoscale mechanical devices

    • Integration with artificial membranes for sustainable energy applications

    • Development of protein-based molecular switches using subunit b conformational changes

  • Expression optimization in synthetic hosts:

    • Adaptation of the S. tropica CNB-4401 heterologous expression platform

    • Codon optimization for diverse expression hosts

    • Design of synthetic operons for coordinated expression of ATP synthase components

These synthetic biology applications leverage the unique properties of S. tropica ATP synthase subunit b, particularly its adaptation to saline environments and potential stability advantages derived from its marine origin.

How does the heterologous expression of S. tropica ATP synthase subunit b compare between different host systems?

Comparative analysis of S. tropica ATP synthase subunit b expression across different host systems reveals significant performance variations:

Host SystemExpression LevelFunctional ActivityPurification YieldKey AdvantagesNotable Limitations
S. tropica CNB-4401HighExcellentMedium-HighNative folding environment; ≈3× higher expression than S. coelicolor Slower growth; requires marine media
S. coelicolor M1152MediumGoodMediumCompatible ΦC31 phage attachment site; extensively engineered Lower expression of marine proteins
E. coli BL21(DE3)VariableVariableHighRapid growth; well-established protocolsRequires extensive optimization; inclusion body formation common
Pichia pastorisMedium-HighGoodMediumEukaryotic processing; high-density culturesGlycosylation may differ; longer development time

The engineered S. tropica CNB-4401 strain offers superior performance for expression of marine actinomycete proteins compared to conventional hosts. This strain was specifically developed by introducing the ΦC31 phage attachment site (attB) into the S. tropica genome while simultaneously eliminating the salinosporamide biosynthetic pathway (salA-C genes) . The resulting strain provides an ideal expression platform with approximately 3-fold higher production of heterologous proteins compared to the extensively engineered Streptomyces host S. coelicolor M1152 .

What are the future research directions for studying S. tropica ATP synthase subunit b and its applications?

Future research directions for S. tropica ATP synthase subunit b encompass several promising areas:

  • Structural biology frontiers:

    • High-resolution structure determination using cryo-electron microscopy

    • Time-resolved structural studies to capture conformational dynamics

    • Investigation of lipid-protein interactions specific to marine environments

  • Functional mechanism investigations:

    • Single-molecule studies of the role of subunit b in rotary catalysis

    • Elucidation of ion specificity mechanisms in high-salt environments

    • Detailed understanding of proton translocation pathways

  • Biotechnological applications:

    • Development of salt-tolerant bioenergetic systems based on S. tropica components

    • Creation of hybrid ATP synthases with enhanced efficiency or novel properties

    • Engineering of pressure-resistant energy systems for deep-sea applications

  • Evolutionary biology perspectives:

    • Comprehensive comparative analysis across marine actinomycetes

    • Investigation of horizontal gene transfer events in ATP synthase evolution

    • Understanding of adaptive mutations in response to marine environmental conditions

  • Expression system refinement:

    • Further optimization of the S. tropica CNB-4401 heterologous expression platform

    • Development of tunable expression systems specifically for marine actinomycete proteins

    • Integration with other marine-derived expression elements for enhanced performance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.