Recombinant Salinispora tropica NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Strop_4055; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440)
Target Names
nuoK
Target Protein Sequence
MNEFFSVEPNYYLVLAAVLFTIGAAGVLVRRNAIVLFMCVELMLNAANLTLVTFSRINGD LNGQIMAFFVMVVAAAEVVVGLAIIMAIYRTRRSASVDDANLLKY
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be a menaquinone. It couples the redox reaction with proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), thereby conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Salinispora tropica and why is it significant in research?

Salinispora tropica is a marine-dwelling actinomycete bacterium with significant and distinct natural product metabolic potential. It is remarkable for its diverse biosynthetic gene clusters (BGCs) that produce bioactive compounds. S. tropica has greater variety of polyketide biosynthetic pathways than other sequenced bacterial genomes, including modular type I PKSs (slm), iterative enediyne type I PKSs (spo and pks1), hybrid type I PKS-NRPSs (sal, sid2, sid3, and lym), heterodimeric type II PKSs (pks2 and pks3), and a homodimeric type III PKS (pks4) . Most notably, S. tropica CNB-440 produces salinosporamide A, a potent anticancer agent, making it valuable for pharmaceutical research . The strain has also been engineered as a heterologous host for expression of biosynthetic gene clusters, further extending its research utility .

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its function?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of Complex I (NADH:ubiquinone oxidoreductase) in the respiratory chain. This integral membrane protein plays a crucial role in energy metabolism by participating in the electron transport chain that generates the proton motive force for ATP synthesis. In Salinispora species, nuoK functions as part of the proton-pumping NADH dehydrogenase, transferring electrons from NADH to quinones while simultaneously translocating protons across the membrane. The protein typically contains transmembrane domains that anchor it within the membrane portion of the respiratory complex. Based on homology with other bacterial species, S. tropica nuoK likely contains multiple transmembrane helices and participates in forming the membrane arm of Complex I.

Why would researchers express nuoK recombinantly rather than isolate it from native S. tropica?

Researchers express nuoK recombinantly for several methodological advantages:

  • Yield optimization: Native expression levels of membrane proteins like nuoK are typically low, making direct isolation inefficient.

  • Purification simplification: Recombinant expression allows for fusion with affinity tags (e.g., His-tag), facilitating purification.

  • Structural studies: For crystallography or cryo-EM studies, pure, homogeneous protein samples are required in quantities difficult to achieve from native sources.

  • Functional analysis: Recombinant expression enables site-directed mutagenesis to analyze structure-function relationships.

  • System simplification: S. tropica produces numerous secondary metabolites that could interfere with purification and analysis, whereas heterologous systems provide a cleaner background .

Which expression systems are most effective for recombinant S. tropica nuoK production?

For effective recombinant production of S. tropica nuoK, several expression systems can be considered:

E. coli-based systems: Based on successful expression of S. arenicola nuoK in E. coli , similar approaches may work for S. tropica nuoK. The BL21(DE3) strain with T7 expression system is often used for membrane proteins, particularly when coupled with specialized vectors containing moderate-strength promoters to prevent aggregation.

Alternative bacterial hosts: Considering S. tropica nuoK is originally from an actinomycete, expression in related hosts like Streptomyces might provide a more native-like membrane environment and proper folding machinery.

Engineered S. tropica: The development of S. tropica CNB-4401 (with attB site and simplified chemical background) provides a potential homologous expression system that could ensure proper folding and processing .

Expression SystemAdvantagesChallenges
E. coli BL21(DE3)Well-established protocols, high yieldsPotential folding issues with membrane proteins
C41/C43 E. coli strainsSpecially designed for membrane proteinsLower yields than standard E. coli strains
Streptomyces systemsRelated to native host, better folding potentialSlower growth, more complex manipulation
Engineered S. tropicaNative processing, authentic modificationsLimited genetic tools, slower growth

What strategies can address the challenges of expressing membrane proteins like nuoK?

Expressing membrane proteins presents significant challenges. The following methodological approaches can help overcome these obstacles:

  • Fusion partners: Addition of solubility-enhancing fusion partners like MBP (maltose-binding protein) or SUMO can improve folding and expression levels.

  • Induction optimization: Lower temperatures (16-20°C) and reduced inducer concentrations often improve proper folding of membrane proteins.

  • Detergent screening: Systematic screening of detergents for membrane protein extraction is critical. For nuoK, mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) may be appropriate starting points.

  • Membrane-mimicking environments: Using nanodiscs, liposomes, or amphipols can help maintain the native conformation during purification and functional studies.

  • Cell-free expression systems: These can directly incorporate membrane proteins into provided lipid environments, potentially improving folding.

For S. tropica nuoK specifically, researchers should consider that this protein evolved in a marine organism, so including salts at concentrations mimicking marine environments might improve stability.

How should recombinant S. tropica nuoK be purified for structural and functional studies?

Purification of recombinant S. tropica nuoK requires careful methodology to maintain protein integrity:

  • Initial extraction: Based on protocols for similar proteins , membrane fractionation followed by solubilization in appropriate detergents is recommended. The membrane fraction containing nuoK should be isolated through differential centrifugation.

  • Affinity chromatography: If expressed with a His-tag (as with S. arenicola nuoK ), IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA or Co-NTA resins provides efficient initial purification.

  • Size exclusion chromatography: This critical step separates properly folded protein from aggregates and ensures detergent micelles contain predominantly monomeric protein.

  • Buffer optimization: Based on S. arenicola nuoK, a Tris/PBS-based buffer at pH 8.0 with appropriate detergent and possibly 6% trehalose for stability is recommended .

  • Quality control: SEC-MALS (Size Exclusion Chromatography-Multi Angle Light Scattering) analysis should be performed to verify the homogeneity and oligomeric state of the purified protein.

The purified protein should be maintained in a stabilizing buffer, and freeze-thaw cycles should be avoided to prevent activity loss .

What techniques are most appropriate for determining the structure of recombinant S. tropica nuoK?

Due to nuoK's nature as a small membrane protein, several complementary structural determination methods should be considered:

X-ray crystallography: Challenging for membrane proteins but possible with lipidic cubic phase crystallization. This requires highly pure, homogeneous protein samples and extensive crystallization condition screening.

Cryo-electron microscopy (cryo-EM): Increasingly powerful for membrane proteins, particularly when nuoK is studied as part of the larger NADH dehydrogenase complex.

Nuclear Magnetic Resonance (NMR): Suitable for smaller membrane proteins like nuoK (105 amino acids in S. arenicola ), particularly using solid-state NMR approaches.

Computational approaches: Homology modeling based on structures from related organisms combined with molecular dynamics simulations can provide structural insights while experimental structures are being pursued.

For optimal results, researchers should consider a hybrid approach, integrating data from multiple techniques to build a comprehensive structural model.

How can researchers evaluate the functional activity of recombinant S. tropica nuoK?

As part of the NADH dehydrogenase complex, nuoK's function should be evaluated using these methodological approaches:

  • Reconstitution experiments: Incorporating purified nuoK into proteoliposomes or nanodiscs with other Complex I components to measure electron transfer activity.

  • NADH oxidation assays: Monitoring NADH oxidation spectrophotometrically at 340 nm using artificial electron acceptors like ferricyanide or ubiquinone analogs.

  • Proton pumping assays: Using pH-sensitive fluorescent dyes (e.g., ACMA) to measure proton translocation in reconstituted proteoliposomes.

  • Membrane potential measurements: Employing potential-sensitive dyes to assess the electrogenic activity of the reconstituted complex.

  • Inhibitor studies: Testing sensitivity to known Complex I inhibitors (rotenone, piericidin A) to confirm authentic activity.

Assay TypeMeasurementEquipment RequiredExpected Result for Active Protein
NADH oxidationAbsorbance decrease at 340 nmSpectrophotometerDecrease in NADH absorbance over time
Proton pumpingFluorescence quenchingFluorometerQuenching of ACMA fluorescence upon complex activation
Electron transferReduction of artificial acceptorsSpectrophotometerColor change or absorbance shift in electron acceptor
Thermal stabilityProtein unfoldingDifferential scanning fluorimetryDefined melting temperature indicative of well-folded protein

How does S. tropica nuoK differ from homologous proteins in other bacterial species?

S. tropica nuoK likely shares core functional features with homologs while exhibiting species-specific adaptations:

  • Marine adaptations: As S. tropica is a marine bacterium, its nuoK may contain adaptations for function in higher salt environments, potentially including modified surface charges or altered hydrophobicity patterns.

  • Sequence conservation: Based on the S. arenicola nuoK, which contains 105 amino acids , the protein likely has highly conserved transmembrane regions with more variable loop regions compared to other bacterial homologs.

  • Interaction interfaces: The surfaces that interact with other Complex I subunits may contain species-specific residues that ensure proper assembly with S. tropica-specific partner proteins.

  • Redox adaptations: Given the unique secondary metabolite profile of S. tropica , its nuoK may have evolved to function within a cellular environment containing distinct redox-active molecules.

Comparative analysis using multiple sequence alignments and evolutionary conservation mapping onto structural models can highlight these differences and their potential functional significance.

How might recombinant S. tropica nuoK contribute to understanding the organism's biosynthetic potential?

S. tropica possesses remarkable biosynthetic capabilities, with numerous secondary metabolite gene clusters . Recombinant nuoK research can provide insights into how energy metabolism supports this biosynthetic potential:

  • Metabolic engineering: Understanding nuoK function may reveal how to optimize energy production to enhance secondary metabolite yields.

  • Redox balance: nuoK's role in maintaining cellular redox state may influence the activity of redox-sensitive biosynthetic enzymes in S. tropica's polyketide synthases and nonribosomal peptide synthetases.

  • Environmental adaptation: Characterizing nuoK can reveal how S. tropica's energy metabolism is adapted to marine environments, potentially explaining its unique biosynthetic profile compared to terrestrial actinomycetes.

  • Heterologous expression host development: Improved understanding of S. tropica's energy metabolism supports engineering it as a heterologous expression host for biosynthetic gene clusters .

What approaches should be taken when experimental data on S. tropica nuoK contradicts existing models?

When encountering contradictory data regarding S. tropica nuoK, researchers should follow this methodological framework:

  • Verify experimental design: Review all experimental parameters, including protein quality, assay conditions, and potential confounding variables .

  • Consider organism-specific factors: S. tropica's marine origin and unique metabolic profile may necessitate modified experimental conditions compared to model organisms .

  • Evaluate assumptions: Assess whether assumptions about nuoK function based on homologs are valid for this specific organism .

  • Refine hypotheses: Develop new hypotheses that accommodate both the contradictory data and previous observations .

  • Design discriminatory experiments: Create targeted experiments specifically designed to distinguish between competing models.

  • Computational validation: Use molecular dynamics simulations to test whether structural or functional differences could explain contradictory results.

  • Consider post-translational modifications: Investigate whether S. tropica-specific modifications affect nuoK function in ways not present in homologs.

This approach transforms contradictory data from a challenge into an opportunity for deeper understanding of species-specific protein function .

How can structural information about S. tropica nuoK inform drug discovery targeting respiratory complexes?

Structural insights about S. tropica nuoK can advance drug discovery through several approaches:

  • Comparative pharmacology: Differences between bacterial and human Complex I components can reveal selective targeting opportunities.

  • Natural product inspiration: S. tropica produces diverse bioactive compounds ; understanding how its own respiratory complexes resist these compounds may reveal new inhibitor design principles.

  • Structure-based design: Detailed structural information about nuoK and its interfaces with other Complex I components can guide the design of inhibitors that disrupt protein-protein interactions essential for complex assembly.

  • Allosteric site identification: Structural analysis may reveal unique binding pockets in S. tropica nuoK that could be targeted without affecting human homologs.

  • Resistance mechanism elucidation: Understanding the structure of respiratory complex proteins from a producer of secondary metabolites can provide insights into how bacteria develop resistance to respiratory inhibitors.

What storage conditions maintain optimal stability of purified recombinant S. tropica nuoK?

Based on protocols for similar membrane proteins and the information available for S. arenicola nuoK , the following storage recommendations can be made:

  • Short-term storage: For periods up to one week, store working aliquots at 4°C to avoid freeze-thaw damage .

  • Long-term storage: Store at -20°C/-80°C with 50% glycerol as a cryoprotectant . Aliquot in small volumes to minimize freeze-thaw cycles.

  • Lyophilization: Lyophilization in the presence of stabilizers like trehalose (6%) may be effective for extended storage .

  • Buffer composition: Maintain in Tris/PBS-based buffer at pH 8.0 with appropriate detergent concentrations .

  • Concentration: Reconstitute protein to 0.1-1.0 mg/mL for optimal stability .

  • Container selection: Use low-binding microcentrifuge tubes to prevent protein adherence to vessel walls.

  • Oxygen exclusion: Consider flushing storage buffers with nitrogen to prevent oxidative damage to sensitive residues.

Researchers should validate storage conditions specifically for S. tropica nuoK through activity assays after various storage periods.

How can researchers troubleshoot poor expression yields of recombinant S. tropica nuoK?

When facing low expression yields, which is common with membrane proteins, researchers should systematically address potential issues:

  • Codon optimization: Analyze the codon usage in the nuoK gene and optimize for the expression host, particularly for rare codons that might cause translational stalling.

  • Expression construct design: Include fusion partners known to enhance membrane protein expression, such as MBP, SUMO, or Mistic.

  • Host strain selection: Test specialized E. coli strains designed for membrane protein expression (C41/C43) or consider expression in actinomycete hosts more closely related to Salinispora.

  • Expression conditions optimization matrix:

ParameterVariables to Test
Temperature37°C, 30°C, 25°C, 20°C, 16°C
Inducer concentration0.01 mM to 1 mM IPTG (for T7 systems)
Media compositionLB, TB, 2xYT, minimal media with supplements
Induction timingEarly log phase to late log phase
AdditivesGlycerol, sorbitol, betaine, salt concentrations
  • Expression timing: Monitor expression at multiple time points to identify optimal harvest time before potential degradation occurs.

  • Alternative approaches: Consider cell-free expression systems specifically designed for membrane proteins or secretion-based systems with appropriate signal sequences.

What are the key considerations when designing experiments to study S. tropica nuoK interactions with other Complex I components?

To effectively study interactions between nuoK and other Complex I components:

  • Co-expression strategies: Design constructs for co-expression of multiple Complex I subunits to facilitate proper assembly and stabilization.

  • Chemical crosslinking: Use membrane-permeable crosslinkers with various spacer lengths to capture transient interactions followed by mass spectrometry analysis.

  • FRET-based approaches: Engineer fluorescent protein fusions or site-specific fluorescent labels to monitor subunit proximity and dynamics.

  • Pull-down assays: Design tagged constructs for affinity purification of intact subcomplexes to identify stable interaction partners.

  • Native mass spectrometry: Optimize gentle ionization conditions to maintain non-covalent interactions for mass analysis of intact complexes.

  • Reconstitution experiments: Systematically combine purified components to determine minimal functional units and assembly dependencies.

  • Genetic approaches: Employ bacterial two-hybrid systems modified for membrane proteins to detect interactions in vivo.

  • Computational predictions: Use coevolutionary analysis and interface prediction algorithms to guide experimental design.

When designing these experiments, researchers should consider that S. tropica may have evolved unique interaction interfaces compared to model organisms due to its distinctive evolutionary history as a marine actinomycete.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.