Recombinant Salmo salar ATP synthase subunit a (mt-atp6)

Shipped with Ice Packs
In Stock

Description

Expression and Production Methodology

Recombinant mt-atp6 is typically expressed in Escherichia coli using bacterial secretion systems due to its hydrophobic nature. While specific protocols for Salmo salar are not detailed in public databases, analogous methods for Salmo trutta mt-atp6 include:

  • Cloning: Insertion of the mt-atp6 coding sequence into a plasmid vector.

  • Expression: Induction in E. coli under optimized conditions (e.g., 16–18°C for proper folding).

  • Purification: Affinity chromatography via an N-terminal His-tag .

ParameterValueSource
Host OrganismE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)

Biochemical Properties and Handling

The recombinant protein is lyophilized or stored in trehalose-containing buffers to maintain stability. Key handling guidelines include:

PropertySpecificationRationale
Storage BufferTris/PBS, 6% trehalose, pH 8.0Prevents protein aggregation
ReconstitutionDeionized water (0.1–1.0 mg/mL)Maintains solubility
Storage Conditions-20°C/-80°C (aliquoted)Avoids freeze-thaw cycles

Role in Mitochondrial Disease

Mutations in mt-atp6 are linked to severe mitochondrial disorders, including:

  • NARP (Neuropathy, Ataxia, Retinitis Pigmentosa): Caused by m.8993T>G/C mutations, leading to impaired ATP synthesis and increased mitochondrial membrane potential .

  • Leigh Syndrome: Associated with defects in complex V assembly and proton translocation efficiency .

MutationFunctional ImpactSource
m.8993T>GReduced ATP synthesis (up to 90% loss)
m.9176T>GImpaired proton pumping efficiency

Comparative Analysis with Related Proteins

SpeciesKey DifferenceFunctional Implication
HumanExtended N-terminal domainEnhanced proton translocation efficiency
BovineConserved acidic residues in aH5Critical for proton binding

Challenges and Limitations

  • Structural Instability: Hydrophobic regions may misfold in E. coli, requiring specialized refolding protocols .

  • Low Availability: Commercial recombinant Salmo salar mt-atp6 is not widely available, as indicated by "Not Available For Sale" status in catalogs .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format we currently have in stock, we are happy to accommodate special requests. Please indicate your desired format in the order notes, and we will fulfill your request if possible.
Lead Time
Delivery timelines may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for arrangements and associated fees.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
To ensure optimal reconstitution, briefly centrifuge the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life of our proteins is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development if possible.
Synonyms
mt-atp6; atp6; atpase6; mtatp6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Salmo salar (Atlantic salmon)
Target Names
Target Protein Sequence
MTLSFFDQFMSPTYLGIPLIAVALTLPWILFPTPSTRWLNNRLITLQGWFINRFTQQLLL PLNLGGHKWAVLLTSLMLFLITLNMLGLLPYTFTPTTQLSLNMGLAVPLWLATVIIGMRN QPTAALGHLLPEGTPVPLIPVLIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATAAF VLMPIMPTVAILTSIVLFLLTLLEIAVAMIQAYVFVLLLSLYLQENV
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) is responsible for generating ATP from ADP using the proton gradient across the mitochondrial membrane, which is established by the electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are interconnected by a central stalk and a peripheral stalk. ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism of the central stalk subunits. This subunit is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Database Links

KEGG: sasa:808313

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of ATP synthase subunit a (mt-atp6) in Salmo salar?

The ATP synthase subunit a (mt-atp6) in Salmo salar is a membrane protein consisting of 227 amino acid residues. The protein includes highly conserved transmembrane domains that form part of the proton channel in the F₀ portion of ATP synthase. According to available protein information, it has a UniProt accession number of Q35920 and is encoded by genes with multiple nomenclatures including mt-atp6, atp6, atpase6, and mtatp6 . The full amino acid sequence includes multiple transmembrane helices that are critical for proton translocation, which powers the rotational mechanism of ATP synthesis.

How does the mt-atp6 subunit contribute to ATP synthesis in mitochondria?

The mt-atp6 subunit forms a critical component of the proton channel within the membrane-embedded F₀ portion of ATP synthase. It provides the transmembrane pathway for protons, allowing them to access the essential ionized carboxylate residues on the c-subunit ring . As protons move from the intermembrane space into the mitochondrial matrix along an electrochemical gradient, they drive the rotation of the c-ring . This rotational energy is mechanically coupled to conformational changes in the F₁ catalytic domain, which synthesizes ATP from ADP and inorganic phosphate. The mt-atp6 subunit is therefore crucial in converting the energy stored in the proton gradient into the mechanical rotation that powers ATP synthesis.

What is the genomic location and organization of the mt-atp6 gene in Salmo salar?

The mt-atp6 gene in Salmo salar is located in the mitochondrial genome, similar to its location in other vertebrates. Based on comparative genomic data, the gene typically spans nucleotide positions similar to the 8527-9207 range reported for human mitochondrial DNA . The gene is part of the mitochondrial respiratory chain complex family and is maternally inherited as part of the mitochondrial genome. The expression region for the recombinant protein includes positions 1-227, representing the full-length protein . Unlike nuclear genes, mt-atp6 lacks introns and is transcribed as part of a polycistronic transcript that is later processed into individual mRNAs.

What expression systems are most effective for producing recombinant Salmo salar mt-atp6?

For recombinant expression of membrane proteins like mt-atp6, bacterial expression systems such as Escherichia coli can be employed with specific modifications to accommodate the hydrophobic nature of the protein. Based on methodologies used for similar ATP synthase components, an E. coli-based expression system with an inducible promoter (such as IPTG-inducible systems) can be effective . To enhance solubility and purification, the protein can be expressed as a fusion construct with a solubility-enhancing partner such as maltose binding protein (MBP), which has been successfully used for other ATP synthase subunits . Alternative expression systems include yeast (Pichia pastoris) or insect cell systems, which may provide better membrane protein folding environments.

What purification strategies yield the highest purity and functional integrity of recombinant mt-atp6?

Purification of recombinant mt-atp6 requires specialized approaches due to its hydrophobic nature. A recommended purification strategy includes:

  • Cell lysis in a buffer containing 20 mM Tris-HCl pH 8.0 with protease inhibitors

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using mild detergents (such as n-dodecyl-β-D-maltoside or digitonin)

  • Affinity chromatography utilizing fusion tags (His-tag or MBP-tag)

  • Size exclusion chromatography for final purification

Importantly, the purified protein should be maintained in a detergent-containing buffer to preserve its native fold and prevent aggregation. For verification of purity, SDS-PAGE followed by immunoblotting with antibodies specific to mt-atp6 can be employed . Functional integrity can be assessed through reconstitution experiments in liposomes and measuring proton translocation activity.

What are the optimal storage conditions for maintaining stability of purified recombinant mt-atp6?

Based on recommendations for similar proteins, purified recombinant mt-atp6 should be stored in a Tris-based buffer with 50% glycerol to prevent freeze-thaw damage . For short-term storage, the protein can be maintained at 4°C for up to one week. For extended storage, -20°C is suitable, while -80°C is optimal for long-term preservation . It is advisable to avoid repeated freeze-thaw cycles, which can lead to protein denaturation and loss of activity. Working aliquots should be prepared to minimize freeze-thaw events. Additionally, the storage buffer should contain appropriate detergent concentrations above the critical micelle concentration to maintain the solubility and native conformation of this membrane protein.

How can researchers verify the correct folding and secondary structure of recombinant mt-atp6?

Verification of correct folding and secondary structure for recombinant mt-atp6 can be accomplished through multiple complementary techniques:

  • Circular Dichroism (CD) Spectroscopy: This technique can confirm the alpha-helical content, which should be high for this transmembrane protein

  • Fourier Transform Infrared Spectroscopy (FTIR): Provides information on secondary structure elements

  • Limited Proteolysis: Correctly folded proteins show specific digestion patterns

  • Thermal Shift Assays: Measures protein stability and can be used to optimize buffer conditions

For membrane proteins like mt-atp6, reconstitution into lipid nanodiscs or liposomes may be necessary before structural analysis to provide a native-like membrane environment. The expected structure should show predominantly alpha-helical characteristics due to the transmembrane nature of the protein.

What methodologies can be used to study the interaction between mt-atp6 and other subunits of ATP synthase?

Studying interactions between mt-atp6 and other ATP synthase subunits requires specialized approaches for membrane protein complexes:

  • Co-immunoprecipitation with antibodies against mt-atp6 or potential interacting partners

  • Chemical cross-linking followed by mass spectrometry to identify interaction sites

  • Bioluminescence Resonance Energy Transfer (BRET) or Förster Resonance Energy Transfer (FRET) for studying interactions in intact cells

  • Surface Plasmon Resonance (SPR) for quantifying binding affinities

  • Reconstitution experiments combining purified subunits to form functional subcomplexes

For particular interest is the interaction between mt-atp6 and the c-ring, which forms the proton translocation pathway. These interactions can be studied by reconstituting the purified proteins into liposomes and measuring proton pumping activity . The F₁ and F₀ subcomplexes can be separately purified and reconstituted to study their functional coupling.

How can the proton translocation function of mt-atp6 be experimentally measured?

The proton translocation function of mt-atp6 can be assessed through various experimental approaches:

MethodMeasurement ParameterAdvantagesLimitations
pH-sensitive fluorescent dyespH changes in liposomesReal-time monitoringPotential dye interference
Patch-clamp electrophysiologyDirect current measurementsSingle-molecule resolutionTechnical complexity
SSM-based electrophysiologyCapacitive currentsHigh sensitivityRequires specialized equipment
Proteoliposome assaysATP synthesis coupled to ΔpHFunctional readoutIndirect measurement

For these assays, the recombinant mt-atp6 should be reconstituted with other essential components, particularly the c-ring, to form a functional proton channel. The experimental setup typically involves creating an artificial proton gradient across a membrane containing the reconstituted protein complex and measuring either proton movement or the resulting ATP synthesis .

What are the most significant mutations in mt-atp6 and how can they be studied using the recombinant protein?

Significant mutations in mt-atp6 have been associated with mitochondrial disorders, including Leigh syndrome. Point mutations such as m.9176T>G result in amino acid substitutions that can impair the function of ATP synthase . To study these mutations using recombinant Salmo salar mt-atp6:

  • Site-directed mutagenesis can be performed on the expression construct

  • Mutant proteins can be expressed and purified using the same protocols as wild-type

  • Functional comparisons between wild-type and mutant proteins can reveal mechanisms of dysfunction

  • Structural studies can identify how mutations affect protein folding or interactions

The heteroplasmic nature of mt-atp6 mutations, where both mutant and wild-type mitochondrial DNA coexist in cells, can be mimicked by creating mixed populations of reconstituted proteoliposomes . This approach allows for studying the threshold effect, where dysfunction occurs only when mutant mtDNA exceeds a certain percentage.

How can recombinant Salmo salar mt-atp6 be used as a model for understanding human mitochondrial diseases?

Recombinant Salmo salar mt-atp6 can serve as a valuable model for understanding human mitochondrial diseases due to significant conservation of structure and function across vertebrates. Researchers can:

  • Introduce equivalent disease-causing mutations found in humans into the salmon mt-atp6 sequence

  • Compare functional impacts with clinical phenotypes

  • Test potential therapeutic compounds on the recombinant system before moving to cellular models

  • Develop structure-function relationships that inform therapeutic strategies

The advantage of using the salmon protein lies in potential differences in stability or expression yield compared to human proteins, while maintaining functional relevance. Studies have shown that mutations in mt-atp6, such as those associated with Leigh syndrome (m.9176T>G), affect the same functional domains across species, making Salmo salar mt-atp6 a relevant model system . The results can provide insights into mechanisms of mitochondrial disorders and potential therapeutic targets.

How does Salmo salar mt-atp6 compare structurally and functionally with mt-atp6 from other species?

Comparative analysis of mt-atp6 across species reveals both conservation and divergence:

SpeciesSequence Identity (%)Key Structural DifferencesFunctional Implications
Homo sapiens~75-80%Minor variations in transmembrane domainsSimilar proton channel properties
Mus musculus~70-75%Conserved catalytic residuesComparable ATP synthesis efficiency
Bos taurus~65-70%Similar membrane topologyUsed in structural studies of ATP synthase
E. coli~30-35%Different subunit composition (a instead of mt-atp6)More amenable to genetic manipulation

Despite sequence variations, the core functional elements of mt-atp6 are highly conserved across vertebrates, including the critical residues involved in proton translocation. The conserved structural features include transmembrane helices that form the proton channel and interaction surfaces with the c-ring . These similarities make comparative studies valuable for understanding fundamental mechanisms of ATP synthesis.

What evolutionary insights can be gained from studying Salmo salar mt-atp6?

Studying Salmo salar mt-atp6 can provide significant evolutionary insights:

  • As an anadromous fish species, salmon have adapted to both freshwater and marine environments, potentially reflected in mitochondrial energy efficiency

  • The evolution of mt-atp6 in relation to temperature adaptation is particularly relevant in poikilothermic organisms like salmon

  • Comparing sequence conservation across teleost fishes can identify functionally critical residues maintained through evolutionary pressure

  • Salmon-specific adaptations in mt-atp6 may relate to their high-energy migration behaviors

The stoichiometry of c-subunits in the ring that interacts with mt-atp6 varies between species (from c₁₀ to c₁₅) and affects the bioenergetic cost of making ATP . Investigating whether Salmo salar has species-specific adaptations in this interaction could reveal evolutionary strategies for optimizing energy production under different environmental conditions.

How can recombinant mt-atp6 be used in reconstitution studies of the complete ATP synthase complex?

Reconstitution of complete ATP synthase complexes using recombinant components represents an advanced research application with several methodological approaches:

  • Stepwise assembly of subcomplexes (F₁ and F₀) separately, followed by combination

  • Co-expression of multiple subunits using polycistronic vectors

  • Hybrid approaches combining recombinant mt-atp6 with native purified components

  • Reconstitution into nanodiscs or liposomes to provide a membrane environment

The recombinant mt-atp6 must be correctly incorporated with the c-ring to form a functional proton channel . This requires careful optimization of lipid composition, detergent removal methods, and buffer conditions. Successful reconstitution can be verified by measuring ATP synthesis activity driven by an artificial proton gradient. These studies can provide insights into the assembly process of ATP synthase and the specific role of mt-atp6 in the complete complex.

What cutting-edge techniques can be applied to study the conformational dynamics of mt-atp6 during proton translocation?

Several cutting-edge techniques can reveal the conformational dynamics of mt-atp6 during function:

  • Single-molecule FRET: By labeling specific residues with fluorophores, conformational changes during proton translocation can be observed in real-time

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides information on solvent accessibility and structural flexibility of different protein regions

  • Cryo-electron microscopy (cryo-EM): Can capture different conformational states of the protein in near-native conditions

  • Molecular dynamics simulations: Using structural data as input, these can model the atomic-level movements during proton translocation

  • Site-directed spin labeling with electron paramagnetic resonance (EPR): Measures distances between labeled residues during functional states

These techniques can address fundamental questions about how proton movement through mt-atp6 is coupled to rotation of the c-ring. Strategic placement of labels or probes at key positions within the recombinant protein can track conformational changes associated with proton binding and release .

What are the most common challenges in expressing and purifying functional recombinant mt-atp6?

Researchers frequently encounter several challenges when working with recombinant mt-atp6:

  • Low expression yields due to toxicity of membrane protein overexpression

  • Protein misfolding and aggregation in heterologous expression systems

  • Inefficient membrane insertion in bacterial hosts

  • Difficulties in solubilizing and maintaining protein stability during purification

  • Potential loss of function during detergent extraction from membranes

To address these challenges, modifications to standard protocols include:

  • Using lower induction temperatures (16-20°C) to slow production and improve folding

  • Employing specialized E. coli strains designed for membrane protein expression

  • Utilizing fusion partners like MBP that enhance solubility and expression

  • Screening multiple detergents to identify optimal solubilization conditions

  • Adding stabilizers such as glycerol to purification buffers

Additionally, the hydrophobic nature of mt-atp6 can lead to challenges in accurate protein concentration determination, requiring specialized methods beyond standard Bradford or BCA assays.

How can researchers validate that recombinant mt-atp6 retains native conformation and functionality?

Validating the native conformation and functionality of recombinant mt-atp6 requires multiple complementary approaches:

Validation ApproachWhat It MeasuresMethodology
Secondary structure analysisAlpha-helical contentCD spectroscopy
Lipid binding assayInteraction with membrane lipidsFluorescence-based assays
Antibody recognitionPreservation of native epitopesImmunoblotting with conformation-specific antibodies
Interaction studiesBinding to partner subunitsCo-immunoprecipitation, SPR
Proton translocationFunctional activitypH-sensitive fluorescent probes in proteoliposomes

The gold standard for functional validation is reconstitution with other ATP synthase components to demonstrate proton-driven ATP synthesis. If the recombinant mt-atp6 correctly assembles with the c-ring and other F₀ components, and the reconstituted complex shows coupling between proton translocation and ATP synthesis, this provides strong evidence for native functionality .

What analytical techniques are most appropriate for characterizing the oligomeric state of recombinant mt-atp6?

Characterizing the oligomeric state of recombinant mt-atp6 requires specialized techniques suitable for membrane proteins:

These techniques can determine whether recombinant mt-atp6 exists as a monomer or forms oligomeric assemblies. This information is crucial for understanding how mt-atp6 interacts with the c-ring, which contains multiple copies of subunit c, to form the functional proton channel of ATP synthase .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.