Recombinant Salmo salar Cytochrome c oxidase subunit 2 (mt-co2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mt-co2; coii; coxii; mtco2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Salmo salar (Atlantic salmon)
Target Names
Target Protein Sequence
MAHPSQLGFQDAASPVMEELLHFHDHALMIVLLISTLVLYIIVAMVSTKLTNKYILDSQE IEIVWTVLPAVILILIALPSLRILYLMDEINDPHLTIKAMGHQWYWSYEYTDYEDLGFDS YMVPTQDLTPGQFRLLETDHRMVVPVESPIRVLVSAEDVLHSWAVPSLGVKMDASPGRLN QTAFIASRPGVFYGQCSEICGANHSFMPIVVEAVPLEHFEKWSTMMLEDA
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (mt-co2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis and transmembrane transport. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme a of subunit 1 to the active site in subunit 1, a binuclear center (BNC) composed of heme a3 and CuB. The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Database Links

KEGG: sasa:808315

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 in Atlantic salmon and what is its function?

Cytochrome c oxidase subunit 2 (mt-co2) in Atlantic salmon is a mitochondrially-encoded protein that forms part of the cytochrome c oxidase complex (Complex IV) in the electron transport chain. It plays a crucial role in the initial transfer of electrons from cytochrome c to the cytochrome oxidase complex, which is essential for ATP production during cellular respiration . The gene encoding this protein is highly conserved across salmonid species, with the full-length CO II gene spanning approximately 703 base pairs in closely related species . This conservation indicates the protein's evolutionary importance in fundamental metabolic processes. Unlike its relative cytochrome c oxidase subunit III (coxIII), which shows significant expression changes during smoltification (the preparatory process for seawater transition), mt-co2 maintains more consistent expression across developmental stages .

How does recombinant mt-co2 differ from native mt-co2 in Atlantic salmon?

Recombinant mt-co2 is produced through heterologous expression systems, typically using bacterial hosts like Escherichia coli, similar to the approach used for human cytochrome c protein production . The key differences between recombinant and native mt-co2 include:

  • Post-translational modifications: Recombinant proteins expressed in bacterial systems lack some post-translational modifications present in the native protein, which can affect functionality.

  • Structural integrity: The recombinant form may contain additional elements such as affinity tags (e.g., polyhistidine tags) to facilitate purification, which are absent in the native protein.

  • Folding dynamics: The folding environment in expression systems differs from the native mitochondrial environment, potentially affecting the three-dimensional structure.

  • Functional activity: While recombinant mt-co2 retains its primary sequence, its electron transfer efficiency may differ from the native form due to the above factors.

Methodologically, researchers working with recombinant mt-co2 must validate its structural and functional similarity to the native form through comparative activity assays and structural analyses.

What are the common expression systems used for producing recombinant Salmo salar mt-co2?

The production of recombinant Salmo salar mt-co2 typically employs bacterial expression systems, with E. coli being the most common, similar to human cytochrome c production methods . Each expression system offers distinct advantages and limitations:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliHigh yield, rapid growth, cost-effective, well-established protocolsLacks post-translational modifications, inclusion body formation, potential endotoxin contamination>95% purity possible with optimization
Yeast (S. cerevisiae/P. pastoris)Some post-translational modifications, secretion possible, lower endotoxinLonger production time, more complex media requirementsModerate to high
Insect cellsBetter post-translational modifications, better foldingHigher cost, technical complexity, slower growthModerate
Mammalian cellsMost authentic post-translational modificationsHighest cost, lowest yield, most complexLow

Methodologically, the choice of expression system should be guided by the specific research requirements. For structural studies where high protein quantity is needed, E. coli systems may be preferable, while functional studies requiring authentic modifications might necessitate more complex expression systems.

How does the amino acid sequence of mt-co2 in Salmo salar compare with other salmonid species, and what are the functional implications?

Comparative analysis of mt-co2 sequences across salmonid species reveals high conservation, with approximately 99% nucleotide homology among Salmo salar, Salmo trutta, and Salmo trutta fario . Despite this high conservation, specific nucleotide polymorphisms (SNPs) exist that may have functional significance:

  • Start codon variations: Between S. t. caspius, S. salar, and S. t. fario, the start codon (methionine) position shows substitutions, which could affect translation initiation .

  • Conserved functional domains: The regions involved in electron transfer and interaction with other subunits of the cytochrome c oxidase complex remain highly conserved.

  • Species-specific variations: The limited SNPs that do exist may represent adaptations to different environmental conditions or metabolic requirements.

Methodologically, researchers investigating these differences would employ multiple sequence alignments followed by structural modeling to predict how sequence variations might affect protein function. Site-directed mutagenesis experiments with recombinant proteins can then validate these predictions by assessing changes in electron transfer efficiency or complex assembly.

What methodologies are most effective for assessing the functional activity of recombinant mt-co2?

The functional assessment of recombinant mt-co2 requires multiple complementary approaches:

  • Spectrophotometric assays: Measuring electron transfer rates between cytochrome c and the cytochrome oxidase complex using purified components.

  • Oxygen consumption measurements: Quantifying oxygen reduction rates as an indicator of cytochrome c oxidase activity.

  • Reconstitution experiments: Incorporating recombinant mt-co2 into membrane vesicles or liposomes containing other components of the electron transport chain.

  • Binding affinity studies: Assessing interaction strengths between recombinant mt-co2 and its electron transport partners using techniques such as isothermal titration calorimetry or surface plasmon resonance.

  • Structural integrity validation: Circular dichroism spectroscopy and thermal stability assays to confirm proper protein folding.

For comprehensive functional assessment, researchers should employ multiple methods and compare results with native protein controls. Data interpretation should account for any modifications to the recombinant protein, such as affinity tags, which might affect activity measurements.

How do environmental factors like elevated CO2 levels affect mt-co2 expression and function in Atlantic salmon?

Environmental CO2 exposure significantly impacts Atlantic salmon physiology, including potential effects on mitochondrial function and mt-co2 expression. Research indicates that:

Methodologically, researchers investigating environmental impacts on mt-co2 should combine gene expression analysis (qPCR, RNA-seq) with functional assays of mitochondrial activity and protein abundance measurements. Long-term exposure studies with controlled CO2 levels are essential for understanding chronic adaptation mechanisms.

What are the critical considerations when designing experiments to study recombinant mt-co2 interaction with nuclear-encoded cytochrome c oxidase subunits?

Investigating interactions between mitochondrially-encoded mt-co2 and nuclear-encoded cytochrome c oxidase subunits presents several experimental design challenges:

  • Expression system compatibility: Ensuring that both recombinant mt-co2 and nuclear-encoded subunits maintain proper folding and post-translational modifications.

  • Assembly conditions: Optimizing buffer composition, pH, temperature, and lipid environment to facilitate complex formation.

  • Interaction verification approaches: Employing multiple complementary techniques such as co-immunoprecipitation, blue native PAGE, FRET analysis, and crosslinking studies.

  • Functional validation: Confirming that reconstituted complexes retain electron transport capability.

  • Stoichiometry control: Ensuring proper molar ratios of all subunits to prevent aggregation or incomplete assembly.

The experimental design should incorporate controls for non-specific interactions and include structural validation of the assembled complexes through techniques like cryo-electron microscopy or native mass spectrometry. For functional studies, researchers should measure electron transfer rates and oxygen consumption to confirm proper complex activity.

How should researchers approach the purification and characterization of recombinant mt-co2 to ensure structural integrity?

Purification and characterization of recombinant mt-co2 require a systematic approach:

Purification StepMethodCritical ParametersQuality Control
Initial extractionChemical or mechanical lysisBuffer composition, protease inhibitors, temperatureSDS-PAGE, Western blot
Affinity chromatographyHis-tag purification for His-tagged constructsImidazole concentration, flow rate, column capacityPurity assessment by SDS-PAGE
Ion exchange chromatographyBased on mt-co2 isoelectric pointSalt gradient, pH, buffer compositionActivity retention check
Size exclusion chromatographyFinal polishing stepFlow rate, sample concentration, column resolutionAggregation assessment
Endotoxin removalFor samples from bacterial expressionTechnique-specific parametersEndotoxin quantification

For characterization, researchers should employ:

  • Circular dichroism spectroscopy to assess secondary structure

  • Fluorescence spectroscopy to evaluate tertiary structure

  • Mass spectrometry for protein identification and modification analysis

  • Thermal shift assays to determine protein stability

  • Limited proteolysis to probe structural integrity

  • Activity assays to confirm functional preservation

Methodologically, maintaining protein in appropriate stabilizing buffers throughout purification and storage is critical, as is minimizing freeze-thaw cycles and exposure to extreme temperatures or pH conditions.

What are the best approaches for studying mt-co2 expression changes during Atlantic salmon smoltification?

Studying mt-co2 expression during smoltification—the process preparing salmon for transition from freshwater to seawater—requires longitudinal experimental designs:

  • Sampling strategy: Collecting gill, liver, kidney, and muscle tissues at defined points throughout the smoltification process (pre-smolt, early smolt, mid-smolt, late smolt, post-smolt stages).

  • Gene expression analysis: Employing qPCR with appropriate reference genes, similar to methods used for coxIII analysis which demonstrated increased expression in smolts .

  • Protein quantification: Western blotting with specific antibodies or targeted proteomics approaches to correlate transcript changes with protein abundance.

  • Functional assays: Measuring cytochrome c oxidase activity in isolated mitochondria from different tissues at various smoltification stages.

  • Environmental variables control: Monitoring and controlling photoperiod, temperature, and water salinity changes that trigger smoltification.

Researchers should incorporate analysis of other mitochondrial genes (such as coxIII, which shows increased expression in smolts ) for comparative purposes and include histological examination of mitochondria-rich cells in gill tissue. Data interpretation should consider tissue-specific differences in expression patterns and correlation with physiological parameters of smoltification.

How should researchers interpret contradictory data when comparing native and recombinant mt-co2 functional studies?

When faced with discrepancies between native and recombinant mt-co2 functional studies, researchers should follow this systematic approach:

  • Protein structure verification: Confirm that the recombinant protein maintains proper folding and structural integrity through spectroscopic techniques.

  • Post-translational modification analysis: Identify differences in modifications between native and recombinant forms that might explain functional discrepancies.

  • Experimental condition assessment: Evaluate whether buffer compositions, reaction conditions, or assay components differ between studies.

  • Interaction partner considerations: Determine if the recombinant mt-co2 is interacting with the same partner proteins as the native form.

  • Methodological sensitivity analysis: Assess whether different detection methods have varying sensitivities that could explain apparent differences.

  • Statistical robustness evaluation: Review the statistical analysis to ensure that observed differences exceed experimental variation.

When contradictions persist despite these assessments, researchers should consider conducting hybrid experiments where recombinant and native proteins are studied simultaneously under identical conditions. Additionally, complementary approaches (e.g., in vitro and in vivo studies) can provide broader context for data interpretation.

What statistical approaches are most appropriate for analyzing gene expression changes in mt-co2 under different environmental conditions?

Analyzing mt-co2 expression changes under varying environmental conditions requires robust statistical methods:

  • Normalization strategy: Employing multiple reference genes validated for stability under the specific experimental conditions, rather than single reference genes which may themselves be affected by treatments.

  • Statistical tests selection:

    • For comparing two conditions: t-tests (parametric) or Mann-Whitney (non-parametric)

    • For multiple conditions: ANOVA with appropriate post-hoc tests (Tukey, Bonferroni) or Kruskal-Wallis for non-parametric data

    • For time-course studies: Repeated measures ANOVA or mixed-effects models

  • Multiple testing correction: Applying Benjamini-Hochberg or similar procedures to control false discovery rates, particularly when analyzing multiple genes or conditions simultaneously.

  • Data visualization: Using box plots, violin plots, or expression heat maps to effectively communicate patterns while showing data distribution.

  • Power analysis: Conducting a priori power calculations to determine appropriate sample sizes for detecting biologically relevant expression differences.

Researchers should also consider employing multivariate analyses such as principal component analysis or partial least squares discriminant analysis to identify patterns across multiple genes or conditions, similar to the approach used in studies of CO2 exposure effects on gill gene expression .

How can researchers effectively compare sequence conservation of mt-co2 across different salmonid species?

Effective comparison of mt-co2 sequence conservation requires a multi-layered analytical approach:

  • Multiple sequence alignment: Using algorithms optimized for closely related sequences (e.g., MUSCLE, MAFFT) to align mt-co2 sequences from different salmonid species.

  • Phylogenetic analysis: Constructing phylogenetic trees using maximum likelihood or Bayesian methods to visualize evolutionary relationships.

  • Conservation scoring: Calculating site-specific conservation scores to identify highly conserved regions versus variable sites.

  • Selection pressure analysis: Determining dN/dS ratios (omega) to identify codons under purifying selection (omega << 1) versus neutral evolution (omega = 1) or positive selection (omega > 1) .

  • Structural mapping: Projecting conservation data onto protein structural models to identify functionally important regions.

  • Functional domain analysis: Correlating conservation patterns with known functional domains involved in electron transfer, subunit interaction, or membrane association.

For salmonid mt-co2, researchers would expect to find high sequence conservation (approximately 99% at nucleotide level) among Salmo salar, Salmo trutta, and related species , with variations potentially occurring in less functionally critical regions. Statistical significance of conservation patterns can be assessed using randomization tests that compare observed conservation to null models.

How does mt-co2 research contribute to understanding mitochondrial dysfunction in fish exposed to environmental stressors?

Research on mt-co2 provides critical insights into mitochondrial responses to environmental stressors in fish:

  • Marker of mitochondrial function: Changes in mt-co2 expression and activity directly reflect mitochondrial adaptation to stressors like elevated CO2, temperature fluctuations, or hypoxia.

  • Integration with physiological adaptation: Studies have shown that Atlantic salmon exposed to elevated CO2 levels (5-40 mg/L) demonstrate significant alterations in osmoregulation and acid-base balance parameters , which likely involve mitochondrial adaptations.

  • Downstream molecular effects: CO2 exposure in Atlantic salmon downregulates genes involved in immune responses and tissue structure maintenance , potentially through pathways influenced by mitochondrial function.

  • Climate change implications: Understanding how mt-co2 responds to environmental changes provides insights into how fish might adapt to projected climate change scenarios, including ocean acidification.

Methodologically, researchers investigating these connections should combine gene expression studies with functional mitochondrial assays and whole-organism physiological measurements. This integrated approach allows for connecting molecular-level changes in mt-co2 to broader physiological adaptations and fitness consequences.

What are the implications of mt-co2 sequence and functional conservation for evolutionary studies in salmonids?

The high conservation of mt-co2 across salmonid species has significant implications for evolutionary studies:

  • Phylogenetic marker utility: Despite high conservation (99% nucleotide homology between Salmo salar and related species ), the specific SNPs in mt-co2 can serve as phylogenetic markers for resolving relationships among closely related salmonid species.

  • Selection pressure insights: Analysis of synonymous versus nonsynonymous substitutions in mt-co2 can reveal selective pressures acting on mitochondrial function throughout salmonid evolution.

  • Co-evolution with nuclear genome: The interaction between mt-co2 and nuclear-encoded components of the electron transport chain necessitates co-evolutionary processes, similar to those observed in other species where COII shows compensatory evolution to match changes in interacting proteins .

  • Environmental adaptation signatures: Variations in mt-co2 sequence or expression across salmonid species adapted to different environmental conditions may reveal mechanisms of metabolic adaptation.

Researchers should employ comparative genomics approaches paired with functional studies to fully understand the evolutionary significance of mt-co2 conservation and variation. This might include reconstructing ancestral sequences and expressing them to test functional hypotheses about evolutionary constraints on mitochondrial function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.