Recombinant Salmo salar Transmembrane protein 85 (tmem85)

What is the structure and function of Transmembrane protein 85 in Salmo salar?

Transmembrane protein 85 (tmem85) in Salmo salar is a full-length protein consisting of 188 amino acids. The complete amino acid sequence is: MASPGGQGGGAVSTRGAGARRMKWALELSLGNARGRGDRQSNQGDVMYPIGYSDK PVPDTSIQETDKNLVEKRCWDVALGPLKQIPMNLFIMYMSGNTISIFPIMMVCMMAWRPIQALMSMSATFKLLENSNQQWLQGLVYSVGNLLGSALAIYKCQSMGLLPTHSSDWLAFIEPPQRMEIMGGGMVL .

Structurally, tmem85 exists as a transmembrane protein that spans cellular membranes. While the specific function of tmem85 in Atlantic salmon has not been fully characterized in the provided literature, it likely plays roles in membrane organization, cellular signaling, or transport functions. Research suggests that transmembrane proteins in this family typically contain multiple membrane-spanning domains that form structural channels or pores across lipid bilayers.

How is Recombinant Salmo salar tmem85 produced for research applications?

Recombinant Salmo salar tmem85 is primarily produced using a baculovirus expression system, which provides several advantages for transmembrane protein expression . The methodological approach involves:

• Gene cloning: The tmem85 coding sequence is isolated from Salmo salar tissue or synthesized based on the known sequence.

• Vector construction: The gene is inserted into a baculovirus transfer vector.

• Transfection: Insect cells are transfected with the recombinant baculovirus.

• Protein expression: The infected cells express the protein of interest.

• Purification: The protein is isolated using chromatographic techniques to achieve >85% purity as verified by SDS-PAGE .

This expression system is particularly suited for transmembrane proteins as it provides a eukaryotic environment with appropriate post-translational modifications while yielding sufficient quantities for research applications.

What protocols should researchers follow for optimal storage and handling of Recombinant Salmo salar tmem85?

For optimal preservation of protein integrity and biological activity, researchers should adhere to the following storage and handling protocols:

• Storage temperature: Store at -20°C for routine use; for extended storage periods, maintain at -80°C .

• Storage buffer composition: The protein is typically supplied in a Tris-based buffer containing 50% glycerol, optimized specifically for tmem85 stability .

• Aliquoting strategy: Upon receipt, briefly centrifuge the vial to ensure contents are at the bottom, then prepare small working aliquots to avoid repeated freeze-thaw cycles .

• Working storage: Aliquots intended for immediate use can be stored at 4°C for up to one week .

• Freeze-thaw management: Repeated freezing and thawing significantly reduces protein activity and should be strictly avoided .

For reconstitution of lyophilized protein, dissolve in deionized sterile water to a concentration of 0.1-1.0 mg/mL, then add glycerol to a final concentration of 5-50% for long-term storage .

How do researchers determine experimental conditions when incorporating Recombinant Salmo salar tmem85 into functional assays?

When designing functional assays with Recombinant Salmo salar tmem85, researchers should consider multiple experimental parameters:

• Buffer composition optimization:

  • pH range testing (typically 6.5-8.0)

  • Ionic strength adjustment

  • Addition of stabilizing agents beyond glycerol

• Temperature sensitivity profiling:

  • Conduct thermal stability assays to determine functional temperature range

  • Consider preincubation conditions that maintain native conformation

• Concentration determination:

  • Establish dose-response relationships in your specific assay

  • Validate protein activity at different concentrations

• Interaction partner identification:

  • Design co-immunoprecipitation experiments with potential binding partners

  • Consider lipid composition when reconstituting into artificial membranes

When analyzing transmembrane proteins like tmem85, researchers might adapt methodologies from studies on human transmembrane proteins such as TMEM205, where recombinant expression platforms coupled with in vivo functional resistance assays have proven effective in elucidating molecular mechanisms .

What methodological approaches can be used to compare Salmo salar tmem85 with human transmembrane proteins?

To conduct comparative studies between Salmo salar tmem85 and human transmembrane proteins, researchers should implement the following methodological approaches:

• Sequence homology analysis:

  • Perform multiple sequence alignment with human transmembrane proteins like TMEM205

  • Identify conserved domains and motifs across species

  • Quantify evolutionary conservation using bioinformatic tools

• Structural modeling and comparison:

  • Generate in silico models using homology modeling techniques

  • Compare predicted transmembrane regions and topologies

  • Analyze conservation of critical functional residues

• Functional substitution experiments:

  • Express Salmo salar tmem85 in human cell lines

  • Assess whether salmon tmem85 can functionally replace human homologs

  • Evaluate changes in cellular phenotypes

• Drug interaction studies:

  • If human homologs have known drug interactions (e.g., TMEM205 with platinum-coordination complexes), test whether Salmo salar tmem85 exhibits similar interactions

  • Quantify binding affinities and compare between species

Studies on human TMEM205 have demonstrated its role in mediating export of platinum-coordination complexes (cisplatin and oxaliplatin), contributing to drug resistance in cancer cells . Comparative studies could investigate whether Salmo salar tmem85 possesses similar transport capabilities or has evolved distinct functions.

How can researchers investigate potential roles of tmem85 in Atlantic salmon physiology?

To elucidate the physiological roles of tmem85 in Atlantic salmon, researchers should consider these methodological approaches:

• Tissue expression profiling:

  • Quantify tmem85 expression across different salmon tissues using qRT-PCR

  • Perform immunohistochemistry to localize protein expression at cellular level

  • Analyze expression changes during different developmental stages

• Loss-of-function studies:

  • Develop CRISPR-Cas9 knockout models in salmon cell lines

  • Analyze resulting phenotypic changes

  • Measure alterations in cellular processes potentially related to membrane transport

• Integration with salmon-specific model systems:

  • Incorporate findings into systems like SalmoSim (an in vitro gut model for Atlantic salmon)

  • Evaluate tmem85 expression in response to different dietary interventions

  • Assess potential roles in nutrient absorption or xenobiotic transport

• Environmental response analysis:

  • Measure tmem85 expression changes in response to environmental stressors

  • Investigate potential roles in osmoregulation during saltwater-freshwater transitions

  • Examine expression patterns during pathogen challenges

This multi-faceted approach allows researchers to build a comprehensive understanding of tmem85's physiological significance while leveraging specialized models developed for salmon research.

What controls and validation methods should be included in experiments using Recombinant Salmo salar tmem85?

A robust experimental design incorporating appropriate controls is essential for research using Recombinant Salmo salar tmem85:

• Experimental controls:

  • Negative control: Buffer-only or irrelevant protein of similar size/structure

  • Positive control: When available, a well-characterized transmembrane protein with known activity

  • Expression system control: Protein expressed in the same system but lacking functional domains

• Protein quality validation:

  • SDS-PAGE with Coomassie staining to confirm >85% purity

  • Western blotting with anti-tag antibodies if the recombinant protein includes tags

  • Mass spectrometry to confirm protein identity and detect potential post-translational modifications

• Functional validation approaches:

  • Circular dichroism to verify proper protein folding

  • Liposome incorporation assays to confirm membrane integration

  • Binding assays with predicted interaction partners

• Specificity controls:

  • Competitive inhibition with non-labeled protein

  • Dose-dependent response validation

  • Mutational analysis of key residues predicted to affect function

These validation steps ensure experimental observations are specifically attributed to tmem85 activity rather than artifacts or contaminants.

What strategies can help researchers overcome technical challenges when working with recombinant transmembrane proteins?

Working with transmembrane proteins presents unique technical challenges that researchers can address through these methodological strategies:

• Solubility optimization:

  • Test multiple detergent classes (ionic, non-ionic, zwitterionic)

  • Evaluate detergent concentration effects on protein stability

  • Consider lipid nanodiscs or amphipols as alternative solubilization systems

• Functional reconstitution approaches:

  • Develop proteoliposome reconstitution protocols with defined lipid compositions

  • Optimize protein-to-lipid ratios for functional studies

  • Validate membrane incorporation using fluorescence or electron microscopy

• Expression enhancement:

  • Modify expression constructs to include solubility-enhancing tags

  • Test different expression temperatures and induction conditions

  • Consider codon optimization for the expression system

• Activity preservation:

  • Implement gentle purification strategies with minimal exposure to harsh conditions

  • Include stabilizing agents throughout purification process

  • Validate activity immediately after purification and after storage intervals

These approaches directly address the challenges inherent to transmembrane protein research and can be adapted from successful studies with other membrane proteins, such as the methodologies developed for TMEM205 characterization .

How should researchers analyze structural data for Recombinant Salmo salar tmem85?

Structural analysis of Recombinant Salmo salar tmem85 requires specific analytical approaches:

• Transmembrane domain prediction:

  • Apply multiple prediction algorithms (TMHMM, Phobius, HMMTOP)

  • Compare predictions to identify consensus transmembrane regions

  • Map conserved motifs to predicted structural elements

• Homology modeling workflow:

  • Identify suitable template structures from related proteins

  • Generate multiple models using different algorithms

  • Validate models through energy minimization and Ramachandran plot analysis

  • Assess model quality using PROCHECK or similar validation tools

• Conformational analysis:

  • If experimental structural data is available, analyze different conformational states

  • Identify potential functional states through molecular dynamics simulations

  • Map sequence variations to structural elements

• Structure-function correlation:

  • Relate predicted structural features to known functions of homologous proteins

  • Design targeted mutations to test structural predictions

  • Develop visualization approaches that highlight key structural elements

These analytical approaches help transform raw structural data into mechanistic insights about tmem85 function.

What statistical approaches are recommended for analyzing experimental data involving Recombinant Salmo salar tmem85?

Statistical analysis of experimental data involving tmem85 should incorporate:

• Experimental reproducibility assessment:

  • Calculate coefficients of variation across technical and biological replicates

  • Perform power analysis to determine appropriate sample sizes

  • Apply Bland-Altman plots to evaluate method agreement when comparing techniques

• Comparative statistical methods:

  • For parametric data: t-tests (paired or unpaired) and ANOVA with appropriate post-hoc tests

  • For non-parametric data: Mann-Whitney U or Kruskal-Wallis tests

  • Multiple comparison correction (Bonferroni, Benjamini-Hochberg) for large datasets

• Dose-response analysis:

  • Fit data to appropriate models (Hill equation, four-parameter logistic)

  • Calculate EC50/IC50 values with confidence intervals

  • Compare potency and efficacy parameters across experimental conditions

• Correlation analysis:

  • Pearson or Spearman correlation for relationships between continuous variables

  • Multiple regression for complex relationships with potential confounding factors

  • Cluster analysis for identifying patterns in high-dimensional data

What unexplored areas of research regarding Salmo salar tmem85 hold promise for scientific advancement?

Several promising research directions remain unexplored for Salmo salar tmem85:

• Comparative genomics:

  • Systematic comparison of tmem85 across fish species to identify evolutionary patterns

  • Examination of gene regulation mechanisms across different aquatic environments

  • Investigation of potential gene duplication events and functional divergence

• Environmental adaptation roles:

  • Exploration of tmem85's potential role in adaptation to varying water temperatures

  • Investigation of expression changes during smoltification (freshwater to saltwater transition)

  • Analysis of potential roles in detoxification of environmental pollutants

• Immune system interactions:

  • Investigation of tmem85 expression during pathogen challenges

  • Exploration of potential roles in cell membrane reorganization during immune responses

  • Examination of interactions with salmon-specific pathogens

• Translation to aquaculture applications:

  • Study of tmem85 expression under different farming conditions

  • Investigation of relationships between tmem85 and fish health biomarkers

  • Development of tmem85-based monitoring tools for fish welfare

These research directions would significantly advance understanding of this protein while addressing gaps in current knowledge about its biological significance.

How might understanding of Salmo salar tmem85 contribute to broader transmembrane protein research?

Research on Salmo salar tmem85 has potential implications for broader transmembrane protein research:

• Evolutionary insights:

  • Contribution to understanding evolutionary conservation of transmembrane protein structure and function

  • Identification of species-specific adaptations in membrane protein architecture

  • Development of evolutionary models for transmembrane protein families

• Drug resistance mechanisms:

  • Investigation of potential parallels with human TMEM205, which mediates platinum-drug export and contributes to chemotherapy resistance

  • Exploration of convergent evolution in drug transport mechanisms

  • Identification of conserved structural elements involved in substrate recognition

• Methodological advancements:

  • Development of improved recombinant expression systems for difficult-to-express transmembrane proteins

  • Refinement of functional characterization approaches for membrane proteins

  • Establishment of improved computational prediction models for transmembrane protein structure

• Aquaculture applications:

  • Application of findings to improve fish health monitoring and management

  • Development of targeted interventions based on transmembrane protein function

  • Creation of diagnostic tools for stress or disease detection