KEGG: sasa:100136521
UniGene: Ssa.192
Vertebrate Ancient (VA) opsin belongs to an ancient family of photopigment proteins that evolved early in the vertebrate lineage. These opsins represent one of the slowly evolving groups of vertebrate photopigment proteins that, alongside TMT-opsins, were already present at the base of the vertebrate evolutionary tree . The evolutionary significance of VA-opsins lies in their conservation across diverse vertebrate taxa, indicating fundamental roles in photoreception beyond the conventional visual system. VA-opsins appear in teleosts, amphibians, and some mammals, though they have been lost in eutherian (placental) mammals, possibly linked to the nocturnal lifestyle of early mammalian ancestors . The persistence of these ancient photoreceptors suggests they serve critical functions in light detection that complement the more specialized visual systems. Interestingly, research has uncovered that VA-opsins exist in multiple variants, with the Vertebrate Ancient-Long (VAL) opsin demonstrating functional photosensitivity while the shorter variant appears to lack this property in reconstitution experiments .
The recombinant partial Salmo salar VA-opsin protein typically comprises amino acids 1-75 of the native sequence and is commonly expressed with an N-terminal His-B2M tag for purification purposes . The protein has a molecular mass of approximately 22.5 kDa and its amino acid sequence is MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN . When properly expressed in E. coli systems, the purity typically exceeds 90% as determined by SDS-PAGE analysis . The VA-opsin protein is generally supplied in a Tris-based buffer with 50% glycerol to maintain stability during storage and transportation . The recombinant protein retains the core membrane-spanning domains that are essential for opsin functionality, though the partial nature of the construct may affect its photosensitive properties compared to the full-length native protein. The UniProt accession number for this protein is O13018, which researchers can reference for additional sequence and structural information .
The gold standard for functional characterization of opsins involves spectroscopic measurement of light absorption following reconstitution with the chromophore 11-cis-retinal. For VA-opsins, this process typically begins with incubating the recombinant protein with 11-cis-retinal (approximately 4 nmol) at 4°C for several hours under dim red light (wavelengths >660 nm) or in complete darkness . Following incubation, protein extraction is performed using a detergent such as dodecyl-β-D-maltoside (approximately 2% solution), and free 11-cis-retinal is converted to retinal-oxime through treatment with neutralized hydroxylamine (final concentration around 50 mM) . Difference absorption spectra can then be recorded to determine the wavelength of maximum absorption (λmax), which provides crucial information about the spectral properties of the opsin. For VAL-opsin from zebrafish, this approach revealed green sensitivity with λmax around 500 nm . Additional functional characterization may include calcium imaging or electrophysiological recordings in cells expressing the opsin to measure light-induced responses. Immunocytochemistry using specific antibodies can complement functional studies by confirming proper membrane localization and expression patterns, as demonstrated in studies that localized VAL-opsin in zebrafish brain and retinal horizontal cells .
Research has revealed significant functional differences between VA-opsin variants, particularly between the standard VA-opsin and its longer variant, VAL-opsin. Functional reconstitution experiments demonstrated that VAL-opsin with bound 11-cis-retinal forms a green-sensitive pigment with a peak absorption (λmax) around 500 nm, whereas the shorter VA-opsin showed no photosensitivity even in the presence of 11-cis-retinal . Both variants share common core sequences in their membrane-spanning domains, but VAL-opsin possesses a significantly longer C-terminal tail that appears critical for proper folding and chromophore interaction . The functional divergence between these variants suggests they may serve different physiological roles. Immunohistochemical studies in zebrafish revealed VAL-opsin immunoreactivity in specific cells surrounding the diencephalic ventricle of the central thalamus, distributed over approximately 200 μm along the rostrocaudal axis, suggesting a role in deep brain photoreception . Additionally, VAL-opsin expression was detected in a subset of non-GABAergic horizontal cells in the zebrafish retina, indicating potential involvement in both visual and non-visual photosensory functions . These findings highlight the importance of distinguishing between VA-opsin variants in experimental design and interpretation, as their different functional properties may reflect specialized adaptations to distinct photosensory tasks.
Multiple lines of evidence indicate that VA-opsins function beyond conventional vision in both non-mammalian vertebrates and potentially in mammals. In zebrafish, immunoreactivity specific to the functionally active VAL-opsin has been localized to cells surrounding the diencephalic ventricle of the central thalamus, an area previously associated with deep brain photosensitivity in teleosts . This localization correlates with von Frisch's classic studies on teleost brain photosensitivity, strongly suggesting that VAL-positive cells represent deep brain photoreceptors . The discovery of VA-opsin expression in non-GABAergic horizontal cells of the zebrafish retina further supports its role in modulating visual information processing beyond direct photoreception . The broad evolutionary conservation of VA-opsins in non-eutherian vertebrates suggests fundamental physiological functions that were later lost or replaced in placental mammals. In humans and other mammals, related opsin families are expressed in various skin cell types, including keratinocytes, melanocytes, dermal fibroblasts, and hair follicle cells, where they appear to mediate processes like wound healing, melanogenesis, hair growth, and skin photoaging . These findings collectively suggest that opsins, including VA-opsin family members, play diverse physiological roles in photosensitivity across multiple tissue types and may represent important targets for understanding how organisms respond to light beyond visual processing.
Several critical factors affect the stability and functional activity of recombinant VA-opsin preparations. Buffer composition significantly impacts protein stability, with Tris-based buffers containing 50% glycerol generally providing optimal preservation of structural integrity during storage . Temperature management is equally crucial, with lyophilized preparations remaining stable for up to 12 months at -20°C to -80°C, while liquid formulations typically maintain stability for 6-12 months at similar temperatures . Multiple freeze-thaw cycles should be strictly avoided, as they progressively denature the protein structure; instead, researchers should store the protein in small aliquots to minimize repeated thawing . For functional studies, all procedures involving 11-cis-retinal reconstitution must be performed under dim red light (wavelengths >660 nm) or complete darkness to prevent unintended photoisomerization of the chromophore . The expression system significantly impacts functionality, with eukaryotic expression systems generally preferred for functional studies as they provide appropriate post-translational modifications and membrane environments for proper protein folding . The presence of the appropriate N-terminal tags can affect both stability and functionality; while His-tags facilitate purification, they may occasionally interfere with chromophore binding in some opsin variants, necessitating careful experimental design and appropriate controls .
When recombinant VA-opsin fails to demonstrate expected photosensitivity, several troubleshooting approaches can help resolve the issue. First, researchers should verify they are working with the appropriate variant, as evidence indicates that the VAL-opsin (with longer C-terminus) demonstrates photosensitivity while the shorter VA-opsin may not . For proteins expressed in bacterial systems, refolding protocols incorporating specific detergents like dodecyl-β-D-maltoside (DDM) at 2% concentration may help restore native conformation . If using E. coli-expressed proteins for functional studies yields poor results, switching to eukaryotic expression systems like HEK293S cells is recommended, as these provide more appropriate cellular machinery for proper opsin folding and post-translational modifications . Chromophore binding issues can often be addressed by extending the incubation time with 11-cis-retinal to 5 hours or longer at 4°C under strict light control (dim red light or darkness) . For spectroscopic characterization challenges, increasing protein concentration or optimizing the difference spectroscopy protocol by carefully controlling the hydroxylamine treatment (50 mM final concentration) to convert free retinal to retinal-oxime can improve signal-to-noise ratios . Additionally, incorporating positive controls such as well-characterized rhodopsin preparations in parallel experiments can help validate experimental conditions and identify specific steps where troubleshooting efforts should focus.
Comparative analyses of VA-opsins across species reveal important evolutionary patterns and functional adaptations. Atlantic salmon (Salmo salar) VA-opsin belongs to a highly conserved family that has been preserved across diverse vertebrate lineages . Unlike rhodopsins, which have undergone significant adaptive evolution at specific amino acid sites like residue 261 in response to different aquatic light environments, VA-opsins appear to show less spectral tuning variation across species . In Atlantic salmon and brown trout (Salmo trutta), populations with different adult habitats (freshwater, brackish, or marine) all maintain the same rhodopsin variants with Tyr261, suggesting that the selective pressure on visual pigments operates primarily during the juvenile freshwater stage rather than adapting to the adult habitat . This contrasts with European and Japanese eels, which spend their juvenile stage in the ocean but most of adult life in freshwater, and possess Phe261 in their rhodopsins . While this specific comparative data focuses on rhodopsins rather than VA-opsins directly, it illustrates the principle that photoreceptor proteins in salmonids may be evolutionarily constrained by their critical role in early life stages. The zebrafish VA and VAL-opsins share core sequence homology with salmon VA-opsin but differ functionally, with evidence suggesting that only the VAL variant forms a functional photopigment with absorption maximum around 500 nm .
Recombinant VA-opsin has significant potential in multiple research domains beyond basic photobiology. In the rapidly evolving field of optogenetics, VAL-opsin's green sensitivity (λmax ~500 nm) offers opportunities to develop novel light-sensitive tools that respond to different wavelengths than conventional channelrhodopsin-based systems, potentially enabling more sophisticated multi-component optogenetic control . In environmental adaptation research, VA-opsin studies in species like Atlantic salmon can provide insights into how photoreceptive systems adapt to changing light conditions during migration between freshwater and marine environments, with potential applications in fisheries management and conservation . The expression of VA-opsin in non-retinal tissues suggests applications in photobiomodulation therapy research, where understanding the molecular mechanisms of extraocular photoreception could lead to improved light-based treatments for conditions ranging from skin disorders to circadian rhythm disruptions . The functional differences between VA and VAL-opsin variants present opportunities for structure-function studies that could elucidate fundamental principles of photopigment evolution and spectral tuning . Additionally, the emerging understanding of opsins in human skin cell types, including keratinocytes, melanocytes, and hair follicle cells, suggests that comparative studies with fish VA-opsins could provide evolutionary context for human photobiology and inform novel approaches to treating skin disorders through targeted phototherapy .