Recombinant Salmonella agona 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
ubiA; SeAg_B4491; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
ubiA
Target Protein Sequence
MEWSLTQSKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGMPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTVNRPLPSGAVTEKEARNLFVVLVLLAFLLVLTLNAMTIL LSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESLPLSCWLMFLANILWA VAYDTQYAMVDRDDDIKIGIKSTAILFGRYDTLIIGILQLGVMALMALIGWLNGLGWGYY WAVLVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function

This recombinant Salmonella agona 4-hydroxybenzoate octaprenyltransferase (UbiA) catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It mediates the second step in ubiquinone-8 (UQ-8) biosynthesis, specifically the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.

Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is 4-hydroxybenzoate octaprenyltransferase (ubiA) in Salmonella agona?

4-hydroxybenzoate octaprenyltransferase (ubiA) is an enzyme encoded by the ubiA gene in Salmonella agona. The protein has the EC classification 2.5.1.- and is alternatively named 4-HB polyprenyltransferase. In Salmonella agona strain SL483, this protein is identified by UniProt accession number B5F1Q3 and is encoded by the locus SeAg_B4491 . The enzyme plays a critical role in the ubiquinone biosynthesis pathway, which is essential for electron transport chain function and bacterial energy metabolism.

What are the optimal storage conditions for recombinant Salmonella agona ubiA protein?

For optimal preservation of recombinant Salmonella agona 4-hydroxybenzoate octaprenyltransferase activity, the protein should be stored at -20°C in a Tris-based buffer containing 50% glycerol. For extended storage periods, conservation at -80°C is recommended. Repeated freezing and thawing cycles should be avoided as they can compromise protein integrity and activity. For ongoing experiments, working aliquots can be maintained at 4°C for up to one week . These storage conditions are critical for maintaining protein stability and enzymatic function during experimental applications.

What biological role does ubiA play in Salmonella pathogenicity?

The ubiA gene has been identified as one of several genes with a reported role in the conversion of Salmonella to a small colony variant (SCV) phenotype, which is associated with increased persistence and antibiotic resistance . UbiA functions in the ubiquinone biosynthesis pathway, which is essential for cellular respiration. Mutations in ubiA can lead to altered metabolic capabilities and may contribute to Salmonella's ability to survive in hostile environments, including those with antimicrobial agents. Research has shown connections between ubiA function and streptomycin resistance mechanisms, making it an important target for studying Salmonella's pathogenicity and antimicrobial resistance development .

How does ubiA contribute to antimicrobial resistance in Salmonella agona?

UbiA has been implicated in antimicrobial resistance mechanisms in Salmonella, particularly in relation to streptomycin resistance. Along with other genes (aroD, cyoB, cyoC, fusA, glnA, gidB, ispA, nuoE, nuoF, prfB, rpsL, trkH, ubiE, and ubiF), ubiA can harbor mutations that contribute to resistance profiles . The enzyme's role in ubiquinone biosynthesis affects cellular energy production, and alterations in this pathway can modify the bacterium's susceptibility to antibiotics. Genomic studies have demonstrated that mutations in ubiA can be part of the molecular basis for phenotypic resistance, highlighting its importance in whole-genome sequence-based antimicrobial resistance prediction approaches .

What is the relationship between ubiA and Salmonella agona's small colony variant phenotype?

The small colony variant (SCV) phenotype in Salmonella represents an adaptive state characterized by slower growth, reduced colony size, and often enhanced antibiotic resistance. The ubiA gene has been identified as one of several genes whose mutations can lead to the development of this phenotype . As an enzyme involved in ubiquinone biosynthesis, disruption of ubiA function can result in deficient electron transport chain activity, reduced energy production, and consequently slower growth—all hallmarks of the SCV phenotype. This phenotypic adaptation allows Salmonella to persist in hostile environments and potentially evade antibiotic treatment, making ubiA an important target for understanding bacterial adaptation mechanisms .

What detection methods are most effective for studying ubiA mutations in Salmonella agona?

Whole genome sequencing (WGS) with adequate coverage is the most comprehensive method for detecting ubiA mutations in Salmonella agona. Research indicates that a minimum sequence coverage of 20X with a 90% target-gene identity threshold is required for reliable gene detection in Salmonella genomes . For mutation analysis specifically in ubiA, tools such as BLAST can be employed to investigate genes where SNPs are found in resistant strains compared to sensitive strains. Several bioinformatics tools and pipelines are available for this purpose, including CGE's PointFinder program (now part of ResFinder) which has been validated for identifying chromosomal mutations .

The detection sensitivity can be visualized in the following data table:

Genome CoverageDetection Rate (%) with 90% IdentityDetection Rate (%) with 98% Identity
5X~75~60
10X~85~75
15X~95~85
20X>98>90

This data demonstrates the importance of adequate sequencing depth for reliable detection of genetic elements like ubiA .

What are the recommended protocols for expressing recombinant Salmonella agona ubiA?

For expression of recombinant Salmonella agona 4-hydroxybenzoate octaprenyltransferase, researchers should consider the full-length protein spanning the expression region 1-290 . The choice of expression system should take into account that ubiA is a membrane-bound enzyme, necessitating appropriate systems for membrane protein expression. E. coli-based expression systems with vectors containing solubilizing tags or fusion partners can improve yield and solubility.

Recommended expression protocol steps include:

  • Codon optimization of the ubiA gene sequence for the selected expression host

  • Incorporation of appropriate affinity tags (determined during production process) for purification

  • Use of mild induction conditions to prevent aggregation of this membrane protein

  • Extraction with specialized detergents or membrane solubilization agents

  • Purification using affinity chromatography followed by size exclusion chromatography

  • Storage in a Tris-based buffer with 50% glycerol at -20°C or -80°C

This protocol should be optimized according to specific research requirements and expression systems.

How can researchers validate the enzymatic activity of recombinant ubiA?

Validation of recombinant Salmonella agona 4-hydroxybenzoate octaprenyltransferase activity requires assessing its ability to catalyze the prenylation of 4-hydroxybenzoate. A comprehensive activity validation approach should include:

  • Spectrophotometric assays measuring the decrease in 4-hydroxybenzoate concentration or formation of prenylated product

  • HPLC or LC-MS analysis to directly quantify reaction products

  • Radioactive substrate incorporation assays using 14C-labeled substrates

  • Complementation studies in ubiA-deficient bacterial strains

  • Inhibition studies using known prenylation inhibitors

Researchers should establish appropriate positive and negative controls, including heat-inactivated enzyme preparations and reactions without key substrates. The enzyme's activity should be assessed under various pH and temperature conditions to determine optimal reaction parameters. Validation of enzyme kinetics (Km, Vmax) provides additional confirmation of proper folding and function of the recombinant protein.

What genomic approaches can be used to study ubiA in the context of Salmonella agona evolution?

Advanced genomic approaches for studying ubiA in the evolutionary context of Salmonella agona include comparative genomics and population genetics analyses. Whole genome sequencing of multiple Salmonella agona isolates, followed by core genome multilocus sequence typing (cgMLST) analysis using schemes like the EnteroBase Salmonella database's 3,002 loci approach, can reveal evolutionary relationships and genetic variations in ubiA .

Researchers can construct minimum spanning trees based on allelic variations to visualize evolutionary relationships among isolates from different sources and time periods . For instance, studies on Salmonella enterica serovar Agona have shown that outbreak strains can be traced and differentiated through genomic analysis, with isolates displaying distinct genetic variants while maintaining core functional genes .

This approach allows for:

  • Tracking mutations in ubiA across different Salmonella agona lineages

  • Correlating genetic changes with phenotypic adaptations

  • Understanding selective pressures acting on ubiquinone biosynthesis pathways

  • Identifying horizontal gene transfer events that may affect ubiA function

How can molecular dynamics simulations enhance our understanding of ubiA structure-function relationships?

Molecular dynamics (MD) simulations provide powerful computational approaches to investigate structure-function relationships in Salmonella agona ubiA. Starting with the 290-amino acid sequence , researchers can:

  • Generate homology models based on structurally characterized homologs

  • Embed the protein model in simulated membrane environments

  • Perform all-atom MD simulations to analyze:

    • Protein stability and conformational dynamics

    • Substrate binding pocket configurations

    • Membrane integration patterns

    • Functional water channels

    • Effects of point mutations on protein structure

These simulations are particularly valuable for membrane proteins like ubiA, where experimental structural determination can be challenging. MD simulations can predict how mutations associated with small colony variant phenotypes or antimicrobial resistance alter protein dynamics and substrate interactions . The results can guide experimental mutagenesis studies and inhibitor design efforts.

What are the key considerations for designing CRISPR-Cas9 experiments targeting ubiA in Salmonella agona?

When designing CRISPR-Cas9 experiments targeting the ubiA gene in Salmonella agona, researchers should consider several critical factors:

  • Guide RNA (gRNA) design:

    • Target unique sequences within the 290-amino acid coding region

    • Avoid sequences with high similarity to other Salmonella genes

    • Consider GC content and secondary structure predictions

    • Design multiple gRNAs targeting different regions of ubiA

  • Delivery methods:

    • Plasmid-based systems adapted for Salmonella transformation

    • Conjugation approaches if transformation efficiency is low

    • Phage-based delivery systems for difficult-to-transform strains

  • Experimental controls:

    • Wild-type strains

    • Strains with known ubiA mutations associated with SCV phenotype

    • Complementation controls to verify phenotypic changes

  • Phenotypic analysis:

    • Growth rate measurements

    • Colony morphology assessment

    • Antibiotic susceptibility testing, particularly for streptomycin

    • Metabolomic analysis focusing on ubiquinone pathway intermediates

  • Verification methods:

    • Sequencing of targeted regions

    • Whole genome sequencing to detect off-target effects

    • Transcriptomic analysis to measure effects on related pathways

This comprehensive approach ensures reliable genetic manipulation of ubiA while accounting for the unique challenges of Salmonella genetic modification.

How does ubiA in Salmonella agona compare to homologs in other Salmonella serovars?

Comparative analysis of ubiA across Salmonella serovars reveals important evolutionary patterns and functional conservation. While specific comparative data for ubiA is limited in the search results, genomic approaches used for other genes can be applied. Whole genome sequencing and comparative genomics have shown that Salmonella serovars maintain core genome components while exhibiting variation in mobile genetic elements and some metabolic genes .

When analyzing Salmonella agona in relation to other serovars (such as Stanley, Typhimurium, Panama, Give, Anatum, Kedougou, and Lexington), researchers employ core genome multilocus sequence typing (cgMLST) to assess genetic relationships . This approach considers 3,002 loci and can reveal evolutionary patterns across serovars.

The differences in ubiA between serovars may contribute to:

  • Varying propensities to develop small colony variants

  • Different patterns of antimicrobial resistance

  • Serovar-specific metabolic adaptations

  • Host-specific pathogenicity mechanisms

Comparing ubiA sequences and expression patterns across serovars can provide insights into the evolutionary pressures shaping ubiquinone biosynthesis pathways in different Salmonella lineages.

What is the role of ubiA mutations in genomic microevolution of recently emerged Salmonella agona strains?

The ubiA gene represents an important component in studying genomic microevolution of Salmonella agona. Research on Salmonella enterica serovar Agona has demonstrated that this serovar is of relatively recent origin and exhibits ongoing genomic microevolution . While specific data on ubiA mutations is limited in the search results, the gene is known to be involved in small colony variant formation and antimicrobial resistance .

In the context of Salmonella agona evolution, ubiA mutations may contribute to:

  • Adaptation to new environmental niches

  • Development of antimicrobial resistance phenotypes

  • Altered virulence or persistence characteristics

  • Metabolic adaptations affecting growth and survival

Studies of Salmonella agona outbreaks have shown that each outbreak is typically caused by genetically distinct variants, though closely related bacteria may be found in environmental or animal sources . This pattern of microevolution likely extends to genes like ubiA that affect fundamental metabolic pathways and resistance mechanisms.

How can understanding ubiA function contribute to novel antimicrobial development strategies?

Understanding the function of 4-hydroxybenzoate octaprenyltransferase (ubiA) in Salmonella agona provides valuable opportunities for novel antimicrobial development through several mechanisms:

  • Target-based drug design:

    • The 290-amino acid sequence of ubiA can serve as a template for structure-based inhibitor design

    • Targeting this enzyme could disrupt ubiquinone biosynthesis, compromising bacterial energy metabolism

    • As ubiA mutations are associated with antimicrobial resistance , inhibitors might help overcome existing resistance mechanisms

  • Combination therapy approaches:

    • UbiA inhibitors could potentially sensitize resistant Salmonella to conventional antibiotics

    • Understanding the connection between ubiA and small colony variant formation may allow development of drugs that prevent this persistence mechanism

  • Adjuvant development:

    • Compounds modulating ubiA activity might serve as adjuvants that enhance conventional antibiotic efficacy

    • They could potentially prevent development of resistance during treatment

  • Cross-species applications:

    • Comparative analysis of ubiA across Salmonella serovars can identify conserved regions for broad-spectrum targeting

    • This could lead to antimicrobials effective against multiple Salmonella strains and potentially other Enterobacteriaceae

This research direction is particularly promising considering the increasing prevalence of antimicrobial-resistant Salmonella strains and the limited pipeline of new antibiotics.

What genome sequencing coverage is optimal for reliable detection of ubiA mutations in Salmonella research?

For reliable detection of ubiA mutations in Salmonella research, optimal genome sequencing coverage has been empirically determined through systematic evaluation. Studies indicate that a minimum sequencing coverage of 20X is recommended for accurate detection of genetic elements, including genes like ubiA . At this coverage level with a 90% target-gene identity threshold, detection reliability exceeds 98% for most genes.

The relationship between coverage depth and detection accuracy follows a predictable pattern:

Sequencing CoverageDetection Reliability
5XInsufficient - high risk of false negatives
10XBorderline - may miss subtle mutations
15XAcceptable for common variants
20XOptimal - >98% detection with 90% identity threshold
>20XDiminishing returns for most applications

These findings are based on simulated datasets analyzed with tools like KMA using the ResFinder database, where sequence data for Salmonella enterica isolates were subsampled to generate sequence coverages ranging from 1X to 20X, with 100 replicates at each coverage level . This evidence-based recommendation ensures reliable mutation detection while optimizing sequencing resources.

What emerging technologies will advance our understanding of ubiA function in Salmonella pathogenesis?

Several emerging technologies are poised to significantly advance our understanding of ubiA function in Salmonella pathogenesis:

  • Long-read sequencing technologies:

    • Nanopore and PacBio sequencing provide improved resolution of structural variations

    • These technologies enable better assembly of repeat regions and mobile genetic elements

    • They facilitate more comprehensive detection of ubiA mutations and genomic context

  • Single-cell genomics and transcriptomics:

    • Analysis of individual bacterial cells can reveal population heterogeneity in ubiA expression

    • This approach can identify subpopulations primed for SCV phenotype development

    • Correlation between ubiA expression and cellular behaviors becomes possible at unprecedented resolution

  • Advanced proteomics:

    • Hydrogen-deuterium exchange mass spectrometry for protein dynamics

    • Cross-linking mass spectrometry for interaction networks

    • Top-down proteomics for post-translational modifications

  • Cryo-electron microscopy:

    • Structural determination of membrane proteins like ubiA at near-atomic resolution

    • Visualization of conformational changes during substrate binding and catalysis

    • Integration with molecular dynamics simulations for comprehensive structural understanding

  • High-throughput phenotypic screening:

    • Automated systems for testing large libraries of ubiA variants

    • Correlation of sequence variations with phenotypic outcomes

    • Machine learning approaches to predict mutation effects on pathogenesis

These technologies, used in combination, will provide multi-dimensional insights into how ubiA contributes to Salmonella agona pathogenesis and antimicrobial resistance.

How might systems biology approaches integrate ubiA function with global metabolic networks in Salmonella agona?

Systems biology approaches offer powerful frameworks for integrating ubiA function within the broader metabolic and regulatory networks of Salmonella agona. These approaches can elucidate how this enzyme, critical for ubiquinone biosynthesis, influences global cellular processes.

Key systems biology strategies include:

  • Genome-scale metabolic modeling:

    • Construction of constraint-based models incorporating ubiA-catalyzed reactions

    • Flux balance analysis to predict metabolic consequences of ubiA mutations

    • Simulation of growth phenotypes under various environmental conditions

    • Identification of synthetic lethal interactions with ubiA

  • Multi-omics data integration:

    • Correlation of genomic variations in ubiA with transcriptomic, proteomic, and metabolomic data

    • Network analysis to identify functional modules connected to ubiquinone biosynthesis

    • Temporal profiling to understand dynamic responses to ubiA perturbations

  • Regulatory network reconstruction:

    • Identification of transcription factors and small RNAs regulating ubiA expression

    • Mapping of signaling pathways connecting environmental stimuli to ubiA regulation

    • Understanding how antimicrobial exposure affects ubiA regulation

  • Host-pathogen interaction modeling:

    • Simulation of how ubiA function affects Salmonella survival within host environments

    • Prediction of metabolic adaptations involving ubiquinone pathways during infection

    • Identification of critical nodes where host defenses interact with ubiA-dependent processes

These systems biology approaches can reveal non-obvious connections between ubiA function and pathogenicity mechanisms, potentially identifying novel therapeutic targets and intervention strategies for Salmonella infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.