Recombinant Salmonella agona ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Role in Energy Metabolism

ATP synthase, including the atpB subunit, plays a critical role in bacterial energy metabolism. In Salmonella, as in other bacteria, ATP synthase generates ATP from ADP in the presence of a proton gradient across the membrane . This proton gradient is generated by electron transport complexes of the respiratory chain during oxidative phosphorylation. The F0 component of ATP synthase, which includes the atpB subunit, forms a channel through which protons flow from the periplasmic space into the cytoplasm, driving the rotation of the central stalk .

Salmonella species can utilize both oxidative phosphorylation (oxphos) and substrate level phosphorylation (SLP) to generate ATP, providing metabolic flexibility during infection and persistence . This metabolic versatility is particularly important for intracellular survival within host cells, such as macrophages and epithelial cells, where nutrient availability may be limited or variable.

ATP Generation Mechanisms

ATP generation in Salmonella occurs through multiple pathways:

  1. Oxidative phosphorylation via ATP synthase (involving atpB)

  2. Substrate level phosphorylation during glycolysis

  3. Substrate level phosphorylation in the TCA cycle

  4. Potential ATP generation during fermentation

The atpB subunit specifically contributes to ATP production through oxidative phosphorylation by facilitating proton translocation across the membrane. This process drives the rotational motion of the ATP synthase complex, which in turn enables the catalytic synthesis of ATP from ADP and inorganic phosphate in the F1 sector of the enzyme .

Clinical Significance of Salmonella agona

Salmonella agona has been increasingly recognized as a prominent cause of gastroenteritis . Recent research has shown that this serovar is a strong biofilm former that can undergo genome rearrangement and enter a viable but non-culturable state while remaining metabolically active . These characteristics are similar to strategies employed by S. Typhi, the cause of typhoid fever, during human infection, which are believed to assist with the transition from acute infection to chronic carriage.

A comprehensive review of 2,233 S. agona isolates from UK infections (2004-2020) revealed interesting patterns in acute and persistent infections . The ability of S. agona to persist in people raises important questions about factors contributing to chronic carriage, with energy metabolism potentially playing a role in this process.

Metabolic Adaptations During Infection

Research has shown that Salmonella serovars that are highly or specifically host-adapted often have reduced metabolic capacity, which is intrinsically linked to their ability to cause systemic and persistent infections . While S. agona is not traditionally considered to be adapted to the human host, persistent S. agona isolates may display some hallmarks of these adaptive traits.

For example, studies have identified the loss of ability to utilize 1,2-propanediol in some persistent S. agona infections . This metabolic change is significant because the inability to utilize 1,2-propanediol is highly associated with host-restricted serovars such as S. Typhi, S. Gallinarum, and S. Pullorum, which cause systemic, typhoid or typhoid-like disease . This suggests that metabolic adaptations, potentially involving changes in energy production pathways where ATP synthase functions, may contribute to the persistence of S. agona in human hosts.

Biofilm Formation and Persistence

Another factor contributing to S. agona persistence is its ability to form biofilms. Interestingly, research has shown that isolates from patients with convalescent and temporary carriage of S. agona had a significantly poorer ability to form biofilms than isolates from patients with acute illness . This reduced biofilm ability associated with persistent infections did not appear to have a genetic basis, as almost all genes associated with Salmonella biofilm formation were found to be present across all isolates .

This suggests that while S. agona strains have the genetic capacity to form biofilms, transcriptional rewiring likely occurs during infection that reduces biofilm production, and these changes are maintained during subsequent laboratory growth . Such changes in gene expression could potentially affect energy metabolism genes, including those involved in ATP synthase function.

Research Applications

Recombinant Salmonella agona ATP synthase subunit a (atpB) protein has several important applications in scientific research:

  1. Structural Studies: The recombinant protein can be used in crystallography and other structural biology techniques to elucidate the three-dimensional structure of ATP synthase components.

  2. Functional Analysis: The protein enables researchers to investigate the mechanistic aspects of ATP synthesis and proton translocation in Salmonella.

  3. Antibody Production: Recombinant atpB can be used to generate specific antibodies for detection and localization studies.

  4. Enzyme Kinetics: Researchers can study the kinetic properties of ATP synthase by incorporating the recombinant atpB subunit into reconstituted systems.

Diagnostic and Therapeutic Potential

The unique properties of Salmonella agona ATP synthase subunit a (atpB) make it potentially valuable for diagnostic and therapeutic applications:

  1. Diagnostic Markers: The protein could serve as a specific marker for the detection of Salmonella agona in clinical and environmental samples.

  2. Vaccine Development: As a membrane protein, atpB could potentially be explored as a component of subunit vaccines against Salmonella infections.

  3. Drug Target Screening: The recombinant protein can be used in high-throughput screening assays to identify compounds that specifically inhibit ATP synthase function in Salmonella.

  4. ELISA-Based Detection: Commercial ELISA kits utilizing recombinant Salmonella agona atpB are available for research purposes , highlighting the protein's utility in immunological detection methods.

Current Limitations and Future Research Directions

Despite the importance of ATP synthase in bacterial metabolism and the potential of atpB as a research tool, several knowledge gaps remain. The precise role of ATP synthase in Salmonella agona virulence and persistence is not fully understood. Additionally, the structural details of how atpB contributes to proton translocation and ATP synthesis in this specific organism require further investigation.

Future research directions might include:

  1. Detailed structural analysis of Salmonella agona ATP synthase, including the arrangement and interaction of the atpB subunit within the complex.

  2. Investigation of how changes in ATP synthase function affect Salmonella agona persistence in human hosts.

  3. Exploration of atpB as a potential target for novel antimicrobial compounds that could selectively inhibit Salmonella growth.

  4. Comparative analysis of ATP synthase components across different Salmonella serovars to identify unique features that might contribute to pathogenicity.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; SeAg_B4096; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
atpB
Target Protein Sequence
MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMF RSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ATP synthase subunit a (atpB) in Salmonella and what is its functional significance?

ATP synthase subunit a, encoded by the atpB gene, is a critical component of the F₀ sector of the F₁F₀ ATP synthase complex in Salmonella. This membrane-embedded subunit forms part of the proton channel that couples proton translocation across the membrane to ATP synthesis or hydrolysis. The subunit a plays an essential role in energy conservation by facilitating proton movement through the F₀ sector, which drives the conformational changes in F₁ required for ATP synthesis. Importantly, this subunit has been identified as a target for virulence proteins such as MgtC, which inhibits ATP synthase activity to promote bacterial survival within macrophages .

Research demonstrates that the interaction between virulence factors and subunit a affects several physiological parameters critical for pathogenicity, including:

  • Proton translocation efficiency

  • ATP synthesis/hydrolysis rates

  • Intracellular ATP levels

  • Cytoplasmic pH homeostasis

These functions make subunit a not only essential for basic bacterial metabolism but also a key player in virulence mechanisms.

How does ATP synthase subunit a contribute to Salmonella pathogenicity?

ATP synthase subunit a contributes to Salmonella pathogenicity through its role in bioenergetics and as a target for virulence factors. The subunit is targeted by the MgtC virulence protein, which inhibits F₁F₀ ATP synthase-promoted proton translocation and ATP synthesis . This inhibition helps maintain physiological ATP levels and cytoplasmic pH, which are crucial for bacterial survival within hostile host environments such as macrophage phagosomes.

When the atpB gene (encoding subunit a) is deleted or inactivated, the bacteria lose the ability to regulate ATP levels and pH homeostasis properly. Studies have shown that an atpB mutant exhibited altered ATP levels similar to those displayed by wild-type Salmonella carrying an mgtC-expressing plasmid . This demonstrates that MgtC exerts its effect on intracellular pH and ATP levels specifically by targeting the F₁F₀ ATP synthase through subunit a.

The importance of this mechanism is highlighted by the fact that various intracellular pathogens, including Salmonella enterica and Mycobacterium tuberculosis, require the MgtC virulence protein to survive within macrophages and cause lethal infections in mice .

What structural features of ATP synthase subunit a enable its interaction with virulence factors?

ATP synthase subunit a contains specific structural domains that facilitate its interaction with virulence factors like MgtC. Although detailed structural information specifically for S. agona ATP synthase subunit a is limited, research on related Salmonella strains has identified key interaction surfaces.

The interaction between MgtC and subunit a occurs at specific binding sites that affect the function of the ATP synthase complex. A particularly important finding is that a single amino acid substitution (N92T) in MgtC attenuates Salmonella pathogenicity by preventing MgtC from interacting with and inhibiting the F₁F₀ ATP synthase . This suggests that the interaction involves specific residues rather than broad structural domains.

Research has established that MgtC's functional interaction with subunit a:

  • Requires the presence of the F₀ a subunit

  • Inhibits ATP-driven proton translocation

  • Affects both ATP synthesis and ATP hydrolysis

  • Is abolished by specific point mutations

These precise molecular interactions provide potential targets for antimicrobial development and further studies of virulence mechanisms.

What expression systems are most effective for recombinant production of Salmonella ATP synthase subunit a?

The expression of membrane proteins like ATP synthase subunit a presents significant challenges due to their hydrophobic nature and complex folding requirements. Based on research protocols for similar membrane proteins in Salmonella, the following expression systems have proven effective:

  • E. coli-based expression systems:

    • BL21(DE3) strains with T7 promoter-based vectors

    • C41(DE3) and C43(DE3) strains specifically developed for membrane protein expression

    • Controlled expression using arabinose-regulated promoters similar to those used for other Salmonella membrane proteins

  • Cell-free expression systems:

    • Particularly useful for toxic membrane proteins

    • Allow direct incorporation into artificial membranes or nanodiscs

When designing expression constructs for subunit a, researchers should consider incorporating:

  • N-terminal or C-terminal purification tags (His6, FLAG, etc.)

  • Fusion partners to enhance solubility

  • Protease cleavage sites for tag removal

  • Codon optimization for the expression host

Research has demonstrated that controlled expression levels are critical, as overexpression of membrane proteins often leads to toxicity and inclusion body formation.

How can I overcome challenges in purifying membrane-bound ATP synthase subunit a?

Purification of membrane proteins like ATP synthase subunit a requires specialized techniques to maintain protein stability and functionality. Based on established protocols for similar membrane proteins, the following approach is recommended:

Step-by-step purification strategy:

  • Membrane isolation:

    • Harvest cells and disrupt by French press or sonication

    • Remove unbroken cells and debris by low-speed centrifugation

    • Isolate membranes by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilization:

    • Solubilize membranes using mild detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or Triton X-100

    • Typical concentrations: 1-2% detergent, 4-10 mg/ml protein

    • Include protease inhibitors to prevent degradation

  • Purification:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for further purification

  • Stability considerations:

    • Maintain detergent above critical micelle concentration throughout purification

    • Consider reconstitution into nanodiscs or liposomes for functional studies

    • Use glycerol (10-20%) to enhance stability during storage

Table 1: Recommended detergents for solubilization and purification of ATP synthase subunit a

DetergentCritical Micelle ConcentrationAdvantagesLimitations
n-Dodecyl-β-D-maltoside (DDM)0.17 mMWidely used, mild, maintains functionRelatively large micelles
Digitonin0.5 mMVery mild, preserves protein-protein interactionsExpensive, heterogeneous
Lauryl maltose neopentyl glycol (LMNG)0.01 mMSmall micelles, high stabilityExpensive
Triton X-1000.2-0.9 mMInexpensive, effectiveUV absorbance, difficult to remove

What approaches can verify the proper folding and functionality of recombinant ATP synthase subunit a?

Verifying the proper folding and functionality of recombinant ATP synthase subunit a is crucial before proceeding to experimental applications. Multiple complementary approaches should be employed:

  • Structural assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure composition

    • Limited proteolysis to probe for correctly folded domains

    • Size exclusion chromatography to assess homogeneity and oligomeric state

  • Functional verification:

    • Reconstitution into liposomes or inverted membrane vesicles

    • ATP synthesis assays using NADH as electron donor and monitoring ATP production via luciferase reaction

    • ATP hydrolysis assays measuring inorganic phosphate release

    • Proton translocation assays using pH-sensitive fluorescent dyes

  • Interaction studies:

    • Binding assays with known interaction partners (e.g., MgtC protein)

    • Co-immunoprecipitation experiments

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC)

Specific functional assays have been developed for ATP synthase activity measurement. For example, research has shown that vesicles prepared from wild-type Salmonella released less phosphate than those from an isogenic mgtC mutant strain, demonstrating the inhibitory effect of MgtC on ATP hydrolysis through its interaction with subunit a .

How can I measure ATP synthase activity in experimental systems containing recombinant subunit a?

Measuring ATP synthase activity involving recombinant subunit a can be accomplished through several complementary approaches that assess different aspects of the enzyme's function:

  • ATP synthesis activity measurement:

    • Prepare inverted membrane vesicles from bacterial cells

    • Energize vesicles with NADH or succinate

    • Monitor ATP production using the luciferase reaction

    • Compare activity with controls lacking functional subunit a

  • ATP hydrolysis activity assessment:

    • Measure inorganic phosphate release using colorimetric assays (malachite green or molybdate)

    • Compare phosphate release between samples with different subunit a variants

    • Control experiments should include specific ATP synthase inhibitors (e.g., DCCD or oligomycin)

  • Proton translocation monitoring:

    • Reconstitute ATP synthase into liposomes containing pH-sensitive fluorescent dyes

    • Add ATP to initiate proton pumping

    • Record fluorescence changes as indicator of proton movement

Research has demonstrated that MgtC inhibits both NADH-driven ATP synthesis and ATP-driven proton translocation through its interaction with subunit a . Similar experimental setups can be used to study recombinant subunit a variants and their interactions with potential inhibitors or activators.

Table 2: Comparison of ATP Synthase Activity Assays

Assay TypeMeasurement ParameterAdvantagesLimitationsTypical Sensitivity
Luciferase ATP detectionLight productionHighly sensitive, real-timeRequires coupled system10^-12 to 10^-15 mol ATP
Phosphate releaseColorimetric detectionSimple, quantitativeEnd-point measurement10^-6 to 10^-8 mol Pi
Proton translocationFluorescence changeDirect measurementComplex setupDepends on dye used
Membrane potentialVoltage-sensitive dyesReal-time, in situIndirect measurementVariable

What genetic approaches can be used to study ATP synthase subunit a function in Salmonella?

Several genetic approaches have proven valuable for studying ATP synthase subunit a function in Salmonella:

  • Gene knockout strategies:

    • Creating atpB deletion mutants using homologous recombination

    • Targetron gene knockout systems similar to those used for other Salmonella genes

    • CRISPR-Cas9 based genome editing for precise modifications

  • Complementation studies:

    • Expression of atpB gene from plasmids in atpB-deficient strains

    • Analysis of phenotype rescue with wild-type versus mutant constructs

    • Use of controlled expression systems such as arabinose-regulated promoters

  • Site-directed mutagenesis:

    • Introduction of specific mutations to study structure-function relationships

    • Creation of point mutations that affect interaction with virulence factors

    • Studies showing a single amino acid substitution in MgtC (N92T) prevents interaction with ATP synthase demonstrate the value of this approach

  • Reporter gene fusions:

    • Fusion of atpB with reporter genes to study expression patterns

    • Use of fluorescent proteins to visualize localization

    • Luciferase reporters to quantify transcriptional activity

These approaches have been successfully used to demonstrate that the effects of MgtC on bacterial energetics result from its ability to interact with the F₁F₀ ATP synthase . Similar strategies can be applied to study additional aspects of subunit a function.

How can protein-protein interactions involving ATP synthase subunit a be effectively studied?

Investigating protein-protein interactions involving ATP synthase subunit a requires specialized approaches that accommodate its membrane-embedded nature. Several effective methodologies include:

  • Co-immunoprecipitation (Co-IP):

    • Use of tagged versions of subunit a to pull down interacting partners

    • Western blot analysis to detect specific interactions

    • Requires careful optimization of detergent conditions to maintain interactions

  • Bacterial two-hybrid systems:

    • Modified for membrane proteins using specialized vectors

    • Allows screening for novel interactions in a cellular context

    • Can be used to map interaction domains

  • Crosslinking approaches:

    • Chemical crosslinkers with various spacer lengths

    • Photo-activatable crosslinkers for capturing transient interactions

    • Mass spectrometry analysis of crosslinked complexes

  • Microscopy-based methods:

    • Förster resonance energy transfer (FRET) for studying interactions in cells

    • Bimolecular fluorescence complementation (BiFC)

    • Single-molecule localization microscopy for spatial distribution

Research has established that MgtC interacts with the a subunit of the F₁F₀ ATP synthase, hindering ATP-driven proton translocation and NADH-driven ATP synthesis in inverted vesicles . These findings demonstrate the value of vesicle-based approaches for studying functional consequences of protein-protein interactions involving membrane proteins.

How does the interaction between MgtC and ATP synthase subunit a contribute to Salmonella virulence?

The interaction between MgtC and ATP synthase subunit a represents a sophisticated virulence mechanism that enables Salmonella to adapt to the hostile environment within host macrophages. This interaction has several critical consequences for bacterial pathogenicity:

  • Regulation of bacterial energetics:

    • MgtC inhibits F₁F₀ ATP synthase-promoted proton translocation and ATP synthesis

    • This inhibition helps maintain physiological ATP levels within macrophages

    • Intracellular ATP levels are ~2.2-fold higher in mgtC mutants compared to wild-type Salmonella

    • The effect is specific to MgtC-ATP synthase interaction, as demonstrated by MgtC N92T mutants that cannot interact with ATP synthase

  • pH homeostasis:

    • The MgtC-subunit a interaction is crucial for maintaining cytoplasmic pH

    • mgtC mutants display an acidic cytoplasm compared to wild-type Salmonella

    • This pH regulation is essential for survival in the acidified phagosome environment

  • Infection dynamics:

    • MgtC is required for survival within macrophages and virulence in mice

    • The inhibition of ATP synthase activity appears to be the primary mechanism by which MgtC promotes pathogenicity

    • This represents a unique strategy where a bacterial protein targets its own ATP synthase, differing from classical secreted virulence factors that target host proteins

Research has conclusively demonstrated that MgtC's virulence role is primarily due to its action on the F₁F₀ ATP synthase. Importantly, a single amino acid substitution in MgtC (N92T) that prevents interaction with ATP synthase also attenuates Salmonella pathogenicity , establishing a direct link between this interaction and virulence.

How do environmental conditions affect ATP synthase subunit a expression and function in Salmonella?

The expression and function of ATP synthase subunit a in Salmonella are dynamically regulated in response to environmental conditions, particularly those encountered during infection:

Research has demonstrated that when Salmonella enters the low Mg²⁺ environment of the macrophage phagosome, mgtC expression is induced, leading to inhibition of ATP synthase activity through interaction with subunit a . This response helps the bacterium adapt to this hostile environment by maintaining appropriate ATP levels and cytoplasmic pH.

Can ATP synthase subunit a be targeted for novel antimicrobial development?

ATP synthase subunit a represents a promising target for antimicrobial development due to its essential role in bacterial bioenergetics and its involvement in virulence mechanisms:

  • Rationale for targeting subunit a:

    • Essential for bacterial energy metabolism and survival

    • Involved in pathogenicity through interaction with virulence factors like MgtC

    • Structural differences from human ATP synthase could enable selective targeting

    • Precedent exists with other antibiotics targeting ATP synthesis (e.g., bedaquiline targeting mycobacterial ATP synthase)

  • Potential inhibition strategies:

    • Small molecules targeting the proton channel function

    • Peptide inhibitors designed to disrupt protein-protein interactions

    • Compounds that lock subunit a in an inactive conformation

    • Agents that enhance MgtC-like inhibitory effects on ATP synthase

  • Challenges and considerations:

    • Need for selectivity against bacterial versus human ATP synthases

    • Requirement for membrane permeability

    • Potential for resistance development

    • Delivery to intracellular bacteria like Salmonella

The close relationship between ATP synthase function and Salmonella virulence, particularly through the MgtC-subunit a interaction , suggests that compounds mimicking or enhancing this natural inhibitory mechanism could effectively attenuate bacterial pathogenicity while also affecting energy production.

How can recombinant ATP synthase subunit a be utilized in vaccine development against Salmonella?

Recombinant ATP synthase subunit a offers several promising avenues for Salmonella vaccine development:

  • As a component in subunit vaccines:

    • Recombinant subunit a or its immunogenic epitopes could be incorporated into subunit vaccines

    • Potential to generate antibodies that might interfere with ATP synthase function

    • Could be combined with other Salmonella antigens for broader protection

  • For attenuated live vaccine development:

    • Controlled expression of atpB could create attenuated strains with reduced virulence

    • Mutations affecting the MgtC-subunit a interaction could attenuate pathogenicity

    • Regulatory systems such as arabinose-controlled expression could be used to develop conditional attenuation strategies

  • As an antigen delivery system:

    • Attenuated Salmonella strains with modified ATP synthase could serve as vectors for delivering heterologous antigens

    • Programmed lysis systems involving ATP synthase regulation could enhance antigen release

    • Similar approaches using regulated expression of genes essential for peptidoglycan synthesis have shown promise

  • For targeted anti-tumor therapy:

    • Salmonella Agona strains with modified ATP synthase could be developed for anti-tumor applications

    • Building on existing work with attenuated S. Agona auxotrophs that have shown efficacy against colorectal tumors

    • Combination of ATP synthase modifications with targeted inactivation of metabolic genes could optimize tumor-targeting properties

Research has demonstrated that genetic modification of Salmonella, including the deletion of various virulence and metabolic genes, can create strains with reduced virulence that maintain anti-tumor properties . Similar approaches could be applied to ATP synthase genes to develop multipurpose vaccine and therapeutic strains.

What role might ATP synthase subunit a play in the environmental persistence of Salmonella agona?

Salmonella Agona is known for its remarkable environmental persistence, particularly in dry food products and production environments . ATP synthase subunit a likely contributes to this persistence through several mechanisms:

  • Energy homeostasis during stress:

    • ATP synthase function is crucial for maintaining energy balance during environmental stress

    • Efficient ATP synthesis enables survival during nutrient limitation

    • The ability to rapidly adjust ATP synthase activity may contribute to adaptation to changing environments

  • Biofilm formation support:

    • S. Agona is known for biofilm production , which enhances environmental persistence

    • ATP production is essential for the metabolic activities required for biofilm formation and maintenance

    • Specific features of S. Agona ATP synthase might optimize energy production under biofilm conditions

  • pH tolerance:

    • ATP synthase contributes to cytoplasmic pH homeostasis

    • This function may enable S. Agona to tolerate pH fluctuations in diverse environments

    • Specialized regulation of ATP synthase activity could contribute to acid tolerance response

  • Genomic considerations:

    • S. Agona exhibits genome rearrangements through recombination between rrn operons

    • These structural variations might affect ATP synthase regulation or function

    • Such genomic adaptations could optimize energy metabolism for persistence in specific niches

While direct evidence specifically linking ATP synthase subunit a to S. Agona environmental persistence is limited, the essential role of ATP synthase in bacterial stress responses and the known persistence characteristics of S. Agona suggest a significant relationship worthy of further investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.