Recombinant Salmonella agona Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; SeAg_B1406; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
clsA
Target Protein Sequence
MTTFYTVVSWLVILGYWVLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAQENSSVASSLFKLCERRQGIAGVKGNQ LQLLTDSDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMVMIDNYIAYTGSM NMVDPRFFKQDAGVGQWVDLMARMEGPVATAMGIVYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTATYAAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSLLVGWASRAFFSELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLVIDDTGFGADLAAVQDDYISRSRLLDARLWVKRPLWQRITERLFY FFSPLL
Uniprot No.

Target Background

Function

Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cardiolipin synthase (cls) and what is its biological function in Salmonella agona?

Cardiolipin synthase (cls) in Salmonella agona is an enzyme that catalyzes the synthesis of cardiolipin, a specialized phospholipid crucial for bacterial membrane structure and function. Cardiolipins are involved in the structural organization of membranes, enzyme functioning, and osmoregulation . In Salmonella agona, the cls enzyme (UniProt ID: B5F4L0) is encoded by the cls gene (locus name: SeAg_B1406) and functions as a transesterification enzyme that combines two phospholipid molecules to form cardiolipin .

The enzyme contains characteristic phospholipase D motifs and typically catalyzes the condensation of two phosphatidylglycerol molecules to form cardiolipin and glycerol. This reaction is critical for maintaining proper membrane fluidity, permeability, and stability under various environmental stresses that Salmonella encounters during infection cycles.

How does bacterial Cardiolipin synthase differ from archaeal Cardiolipin synthase?

The differences between bacterial and archaeal cardiolipin synthases reflect the fundamental differences in membrane lipid composition between these domains of life:

FeatureBacterial Cls (e.g., Salmonella)Archaeal Cls (e.g., M. hungatei)
Lipid substrateFatty acyl chain-based ester phospholipidsIsoprenoid-based ether phospholipids
ProductGlycerol-di-phosphatidyl-cardiolipin (Gro-DPCL)Glycerol-di-archaetidyl-cardiolipin (Gro-DACL)
Substrate selectivityOften more specificOften promiscuous (can use both bacterial and archaeal lipids)
Membrane topologyTwo main transmembrane segmentsSimilar topology with domain-specific variations
Evolutionary conservationForms distinct phylogenetic clustersForms separate evolutionary branches

What expression systems are optimal for producing Recombinant Salmonella agona Cardiolipin synthase?

For successful expression of functional Recombinant Salmonella agona Cardiolipin synthase:

  • E. coli expression system: The most commonly used host for expressing bacterial membrane proteins. For cls expression:

    • Use E. coli codon-optimized synthetic genes to enhance expression efficiency

    • Employ vectors with inducible promoters (e.g., IPTG-inducible) and appropriate fusion tags

    • Expression in E. coli clsABC null strains allows for functional complementation testing

  • Membrane protein expression considerations:

    • Include solubilization steps with appropriate detergents (e.g., n-dodecyl-β-d-maltoside at 2% w/v)

    • Purify using affinity chromatography methods, such as Ni-NTA for His-tagged proteins

    • Optimize temperature, inducer concentration, and expression duration to prevent inclusion body formation

  • Protein recovery and purification:

    • Extract from membrane fractions rather than cytosolic fractions

    • Maintain appropriate buffer conditions with glycerol (e.g., 50%) for stability

    • Store at -20°C or -80°C for extended storage, avoiding repeated freeze-thaw cycles

What are the standard methods for assessing Cardiolipin synthase activity in vitro?

Standard methods for assessing Cardiolipin synthase activity include:

  • LC-MS analysis: The gold standard for quantifying enzyme activity by measuring substrate consumption and product formation

    • Enables detection of specific lipid species based on their mass signatures

    • Can detect both expected products (cardiolipin) and side products (e.g., archaetidic acid)

    • Allows quantification using internal standards for normalization

  • Thin Layer Chromatography (TLC):

    • Simple method for separating and visualizing lipid products

    • Can be quantified by densitometric analysis of stained spots

    • Useful for rapid screening of enzyme activity

  • Fluorescent substrate assays:

    • Employ fluorescently labeled phospholipid substrates

    • Allow real-time monitoring of enzyme kinetics

    • Enable high-throughput screening of enzyme variants or inhibitors

  • Activity verification approach:

    • Incubate purified enzyme with substrate (e.g., archaetidylglycerol)

    • Compare results with no-enzyme controls

    • Normalize levels of substrates and products against internal standards

    • Use statistical analysis (e.g., Student's t-test) to validate significant enzymatic activity

How can we investigate the substrate specificity of Salmonella agona Cardiolipin synthase?

Investigating substrate specificity of Salmonella agona Cardiolipin synthase requires a systematic approach:

  • Substrate panel testing: Evaluate enzyme activity with structurally diverse phospholipids:

    • Test individual diastereomers (e.g., sn1 vs. sn3 configurations) to assess stereochemical preferences

    • Compare natural vs. synthetic substrates with varying acyl chain compositions

    • Examine cross-domain substrates (archaeal vs. bacterial phospholipids)

  • Competition assays:

    • Provide the enzyme with an equimolar mixture of different substrates

    • Identify preferential utilization through LC-MS analysis of substrate consumption rates

    • For example, mixing "palmitoyl-oleoyl phosphatidylglycerol (POPG 16:0/18:1) and di-oleoyl-di-oleoyl-glycerol-di-phosphatidyl-cardiolipin (Gro-DPCL 18:1/18:1/18:1/18:1)" to detect formation of hybrid products

  • Kinetic parameter determination:

    • Measure initial reaction rates at varying substrate concentrations

    • Calculate Km, Vmax, and catalytic efficiency (kcat/Km) for each substrate

    • Create Michaelis-Menten plots to visualize enzyme kinetics

  • Structural basis of specificity:

    • Perform site-directed mutagenesis of putative substrate-binding residues

    • Analyze how mutations affect substrate preference using activity assays

    • Use homology modeling and molecular docking to predict substrate interactions

What approaches can be used to study the role of Cardiolipin synthase in Salmonella pathogenesis?

Studying the role of Cardiolipin synthase in Salmonella pathogenesis involves multiple complementary approaches:

  • Genetic manipulation strategies:

    • Generate cls gene knockouts in Salmonella agona using CRISPR-Cas9 or allelic exchange methods

    • Create point mutations in catalytic residues to produce enzymatically inactive variants

    • Develop conditional knockout systems for temporal control of cls expression

  • Infection models:

    • In vitro cell culture infections with epithelial cells or macrophages

    • Ex vivo tissue models that mimic intestinal environments

    • In vivo animal models of salmonellosis

    • Experimental cross-contamination models to assess survival and transfer in food matrices

  • Stress response analysis:

    • Challenge wild-type and cls-deficient strains with various stressors relevant to infection:

      • Acid stress (stomach-like conditions)

      • Osmotic stress (intestinal environment)

      • Oxidative stress (macrophage phagosome)

      • Antimicrobial peptides (host defense molecules)

  • Membrane biology assessments:

    • Analyze membrane fluidity changes using fluorescence anisotropy

    • Measure membrane potential and permeability

    • Quantify resistance to membrane-targeting antimicrobials

    • Examine localization of virulence-associated membrane proteins

  • Transmission electron microscopy:

    • Visualize membrane ultrastructure in cls mutants compared to wild-type

    • Assess membrane defects during different growth phases

    • Examine septum formation during cell division

What are the considerations for developing Cardiolipin synthase inhibitors as potential antimicrobial agents?

Developing Cardiolipin synthase inhibitors requires several methodological considerations:

  • Target validation approaches:

    • Determine essentiality of cls in Salmonella under various growth conditions

    • Analyze phenotypic consequences of cls inhibition

    • Establish cls as a druggable target through structural and functional studies

  • High-throughput screening frameworks:

    • Develop cell-based assays to monitor cardiolipin levels

    • Design in vitro enzymatic assays amenable to HTS format

    • Establish counter-screening methods to exclude non-specific membrane disruptors

  • Structure-based design considerations:

    • Identify druggable pockets in the enzyme structure

    • Target catalytic residues or substrate binding sites

    • Design transition state analogs that mimic the phosphodiester bond formation

  • Selectivity assessment:

    • Compare inhibitor effects on bacterial vs. mitochondrial cardiolipin synthases

    • Evaluate activity against other phospholipase D-like enzymes

    • Test effects on commensal microbiota

  • Delivery strategies for membrane enzyme inhibitors:

    • Develop lipophilic prodrugs to enhance membrane penetration

    • Consider nanoparticle-based delivery systems

    • Optimize physicochemical properties for bacterial membrane permeability

How can we study the interaction of Cardiolipin synthase with other membrane components in Salmonella?

Investigating Cardiolipin synthase interactions with other membrane components requires specialized techniques:

  • Membrane protein interactome analysis:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Proximity-dependent biotin labeling (BioID) to identify neighboring proteins

  • Dynamic interaction studies:

    • Fluorescence resonance energy transfer (FRET) with fluorescently tagged proteins

    • Bimolecular fluorescence complementation (BiFC)

    • Single-molecule tracking in live cells

  • Lipid raft and membrane microdomain analysis:

    • Detergent-resistant membrane isolation

    • Super-resolution microscopy to visualize protein clustering

    • Correlative light and electron microscopy (CLEM)

  • Functional complex reconstitution:

    • Co-expression of cls with putative interaction partners

    • Reconstitution into liposomes or nanodiscs

    • Activity assays in the presence/absence of interaction candidates

  • Computational approaches:

    • Molecular dynamics simulations of cls in membrane environments

    • Protein-protein docking predictions

    • Network analysis of membrane protein interactions

What methodologies are available for studying the impact of environmental conditions on Cardiolipin synthase activity?

To study environmental influences on Cardiolipin synthase activity:

  • Temperature-dependent activity profiling:

    • Measure enzyme kinetics across temperature ranges relevant to host and environmental niches

    • Determine thermal stability using differential scanning fluorimetry

    • Analyze temperature-dependent conformational changes via circular dichroism

  • pH responsiveness studies:

    • Establish pH-activity profiles using buffered reaction systems

    • Investigate pH-dependent structural changes

    • Develop pH-responsive assay systems that mimic phagosomal acidification

  • Ion and osmolyte effects:

    • Test activity in the presence of varying concentrations of physiologically relevant ions (Mg²⁺, Ca²⁺)

    • Examine effects of osmolytes on enzyme stability and activity

    • Correlate with Salmonella adaptation to osmotic stress environments

  • Oxygen tension considerations:

    • Compare enzyme activity under aerobic vs. anaerobic conditions

    • Develop oxygen-controlled reaction chambers for real-time monitoring

    • Correlate with Salmonella's lifestyle in different host niches

  • Nutrient availability impact:

    • Analyze how carbon source affects cls expression and activity

    • Investigate phosphate limitation effects on cardiolipin synthesis

    • Develop chemically defined media to control nutrient variables

How can we evaluate the evolutionary conservation of Cardiolipin synthase across bacterial species?

Evaluating evolutionary conservation of Cardiolipin synthase involves these approaches:

  • Phylogenetic analysis methods:

    • Construct phylogenetic trees using maximum likelihood or Bayesian approaches

    • Compare cls sequences across diverse bacterial phyla

    • Identify distinct clusters, such as the "two main clusters" observed in archaeal cardiolipin synthases

  • Sequence conservation mapping:

    • Generate multiple sequence alignments of cls homologs

    • Identify highly conserved motifs and residues

    • Create consensus sequence logos, particularly for functionally important regions like "the second hydrophobic region"

  • Structural conservation assessment:

    • Compare predicted or determined structures across species

    • Analyze conservation of hydropathy profiles, as demonstrated by alignment of "E. coli ClsA with the averaged hydropathy profile of its bacterial protein family"

    • Identify conserved topological features such as transmembrane domains

  • Functional complementation studies:

    • Express cls from diverse species in model organism knockout strains

    • Test ability to restore cardiolipin synthesis in heterologous hosts

    • Compare enzymatic parameters across orthologs

  • Synteny analysis:

    • Examine conservation of genomic context around the cls gene

    • Identify co-evolved gene clusters that may function together

    • Trace evolutionary events such as gene duplications or horizontal transfers

What techniques are available for quantifying cardiolipin levels in bacterial membranes?

Techniques for quantifying cardiolipin levels in bacterial membranes include:

  • Liquid Chromatography-Mass Spectrometry (LC-MS):

    • Most precise method for quantifying specific cardiolipin species

    • Can detect molecular species differing in acyl chain composition

    • Requires standardized lipid extraction procedures

    • Allows normalization using internal standards

    • Enables detection of related compounds like archaetidic acid (AA) produced during unsuccessful transfer reactions

  • Thin Layer Chromatography (TLC):

    • More accessible technique for routine analysis

    • Separates cardiolipin from other phospholipids based on polarity

    • Can be coupled with densitometric analysis for semi-quantitative results

    • Various staining methods available (iodine vapor, phosphomolybdic acid)

  • Fluorescent probe-based approaches:

    • Use of cardiolipin-specific dyes like nonyl acridine orange (NAO)

    • Flow cytometry for population-level analysis

    • Fluorescence microscopy for visualization of cardiolipin distribution

    • Enables live-cell monitoring of cardiolipin dynamics

  • 31P Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Non-destructive analysis of phospholipid composition

    • Can distinguish cardiolipin based on unique phosphate signals

    • Allows analysis of membrane dynamics in various conditions

  • Enzyme-linked immunosorbent assay (ELISA):

    • Utilizes cardiolipin-specific antibodies

    • Enables high-throughput screening of multiple samples

    • Available as commercial kits for standardized analysis

What are the methodological considerations for studying Cardiolipin synthase mutants?

When studying Cardiolipin synthase mutants, researchers should consider:

  • Mutation design strategy:

    • Target catalytic residues within conserved HKD motifs

    • Modify substrate binding regions to alter specificity

    • Create truncations to determine minimal functional domains

    • Design chimeric enzymes to investigate domain-specific functions

  • Expression system considerations:

    • Use inducible promoters for precise control of expression timing and level

    • Utilize complementation systems in cls-deficient strains

    • Consider the impact of expression tags on protein folding and activity

    • Validate protein expression via Western blotting with tag-specific antibodies

  • Phenotypic characterization approach:

    • Growth curve analysis under various stress conditions

    • Membrane integrity assessment using fluorescent dyes

    • Cell morphology examination via microscopy

    • Antibiotic susceptibility testing, especially for membrane-targeting compounds

  • Biochemical activity assessment:

    • Compare wild-type and mutant enzyme kinetics

    • Analyze substrate specificity changes

    • Determine alterations in product profiles via LC-MS

    • Measure hydrolytic side reactions (e.g., phospholipase D activity)

  • Structure-function correlation:

    • Use circular dichroism to assess secondary structure changes

    • Employ limited proteolysis to examine conformational differences

    • Apply computational modeling to predict mutation effects

    • Consider detergent effects on mutant protein stability

How can lipidomic approaches enhance our understanding of Cardiolipin synthase function?

Lipidomic approaches offer powerful tools for understanding Cardiolipin synthase function:

  • Global lipidomic profiling:

    • High-resolution mass spectrometry to identify all lipid species

    • Comparison of wild-type and cls mutant membrane composition

    • Detection of compensatory changes in other phospholipids when cardiolipin synthesis is altered

    • Monitoring of precursor accumulation (e.g., phosphatidylglycerol)

  • Stable isotope labeling:

    • Incorporate isotopically labeled precursors (e.g., 13C-glycerol)

    • Track flux through the cardiolipin synthesis pathway

    • Determine turnover rates of cardiolipin in different growth conditions

    • Identify alternative synthetic routes when cls is inhibited

  • Spatial lipidomics:

    • MALDI imaging mass spectrometry of bacterial colonies

    • Subcellular fractionation to analyze domain-specific lipid compositions

    • Visualization of cardiolipin-enriched membrane domains

    • Correlation with protein localization data

  • Targeted lipidomic analysis:

    • Multiple Reaction Monitoring (MRM) for specific cardiolipin species

    • Quantification of cardiolipin remodeling intermediates

    • Analysis of acyl chain composition under various stressors

    • Detection of oxidized cardiolipin species during stress responses

  • Integration with other -omics data:

    • Correlate lipidomic changes with transcriptomic alterations

    • Connect membrane composition to metabolomic profiles

    • Develop predictive models of lipid metabolism regulation

    • Identify potential compensatory mechanisms in cls mutants

What future research directions are promising for Salmonella agona Cardiolipin synthase studies?

Promising future research directions include:

  • Structural biology advances:

    • Cryo-electron microscopy to determine membrane-embedded cls structure

    • Time-resolved structural studies to capture catalytic intermediates

    • Investigation of conformational changes during substrate binding and product release

    • Structure-guided inhibitor design targeting Salmonella-specific features

  • Synthetic biology applications:

    • Engineer cls variants with novel substrate specificities

    • Develop biosensors for cardiolipin detection in live cells

    • Create synthetic minimal membranes with defined cardiolipin content

    • Explore cls as a tool for synthesizing novel phospholipid structures

  • Host-pathogen interaction studies:

    • Investigate how host immunity targets bacterial cardiolipin

    • Examine cardiolipin's role in Salmonella survival within macrophages

    • Study the impact of cardiolipin on host immune receptor signaling

    • Develop cardiolipin-based adjuvants for Salmonella vaccines

  • Systems biology integration:

    • Create comprehensive models of phospholipid metabolism

    • Map regulatory networks controlling cls expression

    • Investigate metabolic dependencies on cardiolipin synthesis

    • Develop predictive models of membrane adaptation to environmental changes

  • Translational research avenues:

    • Explore cls as a target for novel antimicrobials

    • Investigate cardiolipin-dependent virulence mechanisms

    • Develop diagnostic tools based on Salmonella-specific cardiolipin profiles

    • Create cls-based biosensors for Salmonella detection in food safety applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.