Recombinant Salmonella agona Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
rsxE; SeAg_B1720; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
rsxE
Target Protein Sequence
MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV
Uniprot No.

Target Background

Function
RnfE is a component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane. It plays a crucial role in maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant RnfE?

For recombinant expression of Salmonella agona RnfE, E. coli-based expression systems have proven most effective due to compatibility with bacterial membrane proteins . When selecting an expression system, consider:

For optimal expression of functional RnfE, induction protocols should be modified to include lower IPTG concentrations (0.1-0.5 mM) and reduced induction temperatures (16-25°C) to prevent aggregation of this transmembrane protein.

What purification strategies work best for recombinant RnfE?

Purification of recombinant His-tagged RnfE requires specialized approaches for membrane proteins:

  • Solubilization: Use mild detergents like n-dodecyl β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at 1-2% concentration to extract RnfE from membranes while maintaining protein structure.

  • Affinity Chromatography: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins effectively captures the His-tagged RnfE . Wash buffers should contain low imidazole concentrations (10-20 mM) and 0.1% detergent to reduce non-specific binding.

  • Size Exclusion Chromatography: For higher purity, especially for structural studies, follow IMAC with size exclusion chromatography using buffers containing 0.05% detergent.

  • Quality Assessment: Verify purity using SDS-PAGE (>90% purity is achievable) and Western blotting with anti-His antibodies.

What methods can verify the activity of purified recombinant RnfE?

Functional verification of RnfE requires assessment of its electron transport capabilities:

  • Reconstitution into Liposomes: Incorporate purified RnfE into artificial membrane systems using a lipid-to-protein ratio of 50:1 to 100:1.

  • Electron Transport Assays: Measure electron transfer using:

    • Redox-sensitive dyes (methylene blue, resazurin)

    • Oxygen consumption rates

    • Membrane potential measurements with voltage-sensitive probes

  • Coupled Enzyme Assays: Assess interaction with partner proteins in the Rnf complex through reconstituted systems.

  • Structural Integrity Assessment: Circular dichroism spectroscopy can verify proper folding of the membrane protein domains.

How should recombinant RnfE be optimally stored to maintain activity?

Proper storage of recombinant RnfE is critical for maintaining functionality:

  • Short-term Storage: Store working aliquots at 4°C for up to one week .

  • Long-term Storage:

    • Store at -20°C/-80°C in small aliquots to prevent repeated freeze-thaw cycles

    • Add glycerol to a final concentration of 50% to prevent protein denaturation during freezing

    • For lyophilized preparations, store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Reconstitution Protocol:

    • Centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • For extended stability, add 5-50% glycerol before aliquoting

Repeated freeze-thaw cycles significantly reduce activity, with approximately 25% activity loss per cycle observed in similar membrane proteins.

How is RnfE involved in Salmonella pathogenicity and survival?

The role of RnfE in Salmonella pathogenicity relates to its function in redox homeostasis and energy metabolism:

  • Redox Balance: The Rnf complex containing RnfE contributes to maintaining proper NAD+/NADH ratios during infection, which is critical when bacteria face oxidative stress within host cells.

  • Metabolic Adaptation: During host colonization, Salmonella must adapt to varying nutrient conditions. The electron transport functions of RnfE enable metabolic flexibility for utilizing different electron donors/acceptors.

  • Genomic Conservation: Genomic analyses of Salmonella Agona outbreak strains from 1998 and 2008 show remarkable conservation of core genome components, including electron transport machinery . This conservation suggests fundamental importance to bacterial survival.

  • Experimental Approaches: To study RnfE's role in pathogenicity:

    • Generate knockout mutants using CRISPR-Cas9 or lambda Red recombination

    • Conduct competitive infection assays comparing wild-type and ΔrnfE strains

    • Measure bacterial survival under various stressors (oxidative, acid, nutrient limitation)

How do genomic variations in RnfE compare across different Salmonella strains?

Comparative genomic analysis reveals important insights about RnfE conservation:

  • Conservation Patterns: Within Salmonella Agona, whole genome sequencing shows remarkable conservation of core genes between outbreak strains separated by 10 years, with minimal SNP differences . This suggests strong selective pressure for maintaining functional electron transport machinery.

  • Outbreak Strain Comparisons: Analysis of outbreak strains from 1998 and 2008 showed only 8 SNP differences in the core genome on average , indicating high conservation of essential proteins like RnfE.

  • Functional Domains: The transmembrane regions and conserved charged residues of RnfE show the highest sequence conservation across Salmonella strains, reflecting their importance in electron transport function.

  • Analytical Methods: For comparative analysis:

    • Whole genome alignment using MAUVE or similar tools

    • SNP analysis using pipelines such as CFSAN SNP Pipeline

    • Targeted sequencing of rnfE with surrounding genetic context

What experimental approaches can characterize RnfE interactions with other components of the electron transport complex?

Understanding RnfE's protein-protein interactions requires specialized approaches:

  • Crosslinking Studies:

    • Use membrane-permeable crosslinkers (DSP, formaldehyde)

    • Apply in vivo crosslinking followed by affinity purification

    • Identify interaction partners by mass spectrometry

  • Co-immunoprecipitation:

    • Express epitope-tagged RnfE in Salmonella

    • Solubilize membranes with mild detergents

    • Capture protein complexes with antibodies against the tag

    • Identify co-precipitating proteins by Western blot or mass spectrometry

  • Bacterial Two-Hybrid Systems:

    • Adapt membrane protein-specific variants like BACTH

    • Screen for interactions with other Rnf complex components

    • Quantify interaction strength through reporter gene expression

  • In vitro Reconstitution:

    • Purify individual components of the Rnf complex

    • Reconstitute with defined lipid compositions

    • Measure assembly using analytical ultracentrifugation or native gel electrophoresis

    • Assess functional reconstitution through electron transport assays

What are common challenges in working with recombinant RnfE and how can they be addressed?

ChallengeCauseSolution
Poor expressionToxicity to host cellsUse tight expression control (T7-lac); lower induction temperature (16°C)
Inclusion body formationImproper foldingAdd solubility tags; use specialized hosts like C41/C43; induce at OD600 of 0.4-0.6
Loss of activity during purificationDetergent-mediated denaturationTest multiple detergents (DDM, LMNG, GDN); maintain critical micelle concentration
Aggregation after storageFreeze-thaw damageAdd 50% glycerol; store small aliquots; avoid repeated freeze-thaw cycles
Non-reproducible functional assaysVariable reconstitutionStandardize lipid composition; control protein-to-lipid ratios; verify orientation in liposomes

How can structural studies of RnfE be optimized?

Structural characterization of membrane proteins like RnfE presents unique challenges:

  • Crystallization Approaches:

    • Screen detergents systematically, with focus on maltoside-based (DDM, UDM) and newer amphipathic detergents

    • Consider lipidic cubic phase crystallization specifically designed for membrane proteins

    • Try fusion protein approaches with crystallization chaperones (T4 lysozyme, BRIL)

  • Cryo-EM Studies:

    • Use nanodisc reconstitution to provide native-like lipid environment

    • Apply focused classification to address conformational heterogeneity

    • Consider GraFix method to stabilize multi-subunit complexes

  • NMR-Based Approaches:

    • Target specific domains using selective isotope labeling

    • Consider solid-state NMR for full-length protein in lipid bilayers

    • Use specific detergent micelles optimized for solution NMR

  • Sample Quality Assessment:

    • Check homogeneity by size-exclusion chromatography coupled with multi-angle light scattering

    • Verify secondary structure content by circular dichroism before structural studies

    • Assess thermal stability through differential scanning fluorimetry with membrane protein-specific dyes

How can recombinant RnfE contribute to developing anti-Salmonella therapeutics?

The essential nature of electron transport in bacterial survival makes RnfE a potential therapeutic target:

  • Target Validation Approaches:

    • Determine if RnfE is essential under infection-relevant conditions

    • Assess virulence attenuation in rnfE conditional mutants

    • Evaluate fitness costs of RnfE inhibition in different infection models

  • Inhibitor Discovery Platforms:

    • Develop high-throughput assays measuring RnfE-dependent electron transport

    • Conduct virtual screening against structural models

    • Design peptidomimetics targeting critical protein-protein interfaces

  • Translational Considerations:

    • Evaluate selectivity against human mitochondrial electron transport chains

    • Assess membrane permeability of potential inhibitors

    • Test for resistance development in laboratory evolution experiments

Understanding RnfE's role in persistent Salmonella infections, such as those observed in the 1998 and 2008 outbreaks separated by 10 years , could provide insights into bacterial persistence mechanisms and inform more effective therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.