Recombinant Salmonella agona Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Salmonella agona Fumarate Reductase Subunit D (FrdD)

Salmonella agona is a bacterium known to cause foodborne outbreaks, and its ability to persist in food environments is well-documented . Fumarate reductase is an enzyme involved in the anaerobic respiration of various organisms, including Escherichia coli . It facilitates the reduction of fumarate by oxidizing a quinol and transferring electrons through iron-sulfur clusters to a FAD molecule .

Recombinant Salmonella agona Fumarate Reductase Subunit D (FrdD) is a component of the fumarate reductase enzyme complex . Specifically, FrdD is essential for membrane association of fumarate reductase and for the oxidation of reduced quinone analogues . The fumarate reductase enzyme consists of four subunits (FrdA, FrdB, FrdC, and FrdD), and all four subunits are required for the restoration of anaerobic growth .

Function and Mechanism

Fumarate reductase is crucial for energy production in anaerobic conditions, where it serves as the terminal electron acceptor in the electron transport chain, allowing bacteria to grow when aerobic respiration or fermentation are not viable .

The enzyme mechanism involves the oxidation of a quinol bound to subunit C, followed by electron transfer down a chain of iron-sulfur clusters to a FAD molecule . The short distances between these electron receptors facilitate electron transfer at a physiologically reasonable timescale . The FAD molecule, located at the catalytic site, then reduces fumarate through hydride attack .

Role of FrdD in Fumarate Reductase Complex

FrdD is required for the assembly of a functional fumarate reductase complex . Separation of the DNA coding for FrdC and FrdD affects the ability of fumarate reductase to assemble into a functional complex . Both FrdC and FrdD are required for membrane association of fumarate reductase and for the oxidation of reduced quinone analogues .

Relation to Succinate Dehydrogenase

Succinate dehydrogenase (SQR) is related to fumarate reductase, and both enzymes have some functional overlap and redundancy in various organisms . SQR is a key enzyme in the citric acid cycle and electron transport chain, catalyzing the opposite reaction of fumarate reductase by coupling quinone reduction to succinate formation . Both SQR and fumarate reductase belong to the SQR_QFR_TM protein domain family and share similar structures .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
frdD; SeAg_B4618; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMLPLGLFPGDALSFERVLTFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTAIGVITL
Uniprot No.

Target Background

Function
Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (used in anaerobic growth) and succinate dehydrogenase (used in aerobic growth). Fumarate reductase subunit D anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the frdD gene in Salmonella agona?

The frdD gene in Salmonella agona is part of the frd operon (typically containing frdABCD) that encodes the four subunits of fumarate reductase, an essential enzyme for anaerobic respiration. In Salmonella, this operon is typically regulated by oxygen availability and is expressed under anaerobic conditions. Whole-genome sequence analysis of Salmonella Agona isolates has revealed high conservation of metabolic genes across different strains, even those separated by significant temporal gaps such as the 1998 and 2008 outbreak isolates . To examine the genomic context experimentally:

  • Perform whole-genome sequencing using platforms such as Pacific Biosciences RS II Sequencer for complete genome determination

  • Use bioinformatics tools like MAUVE aligner for comparative genomic analysis

  • Analyze SNP patterns in and around the frd operon using pipelines such as CFSAN SNP Pipeline

  • Verify gene arrangement through PCR amplification using primers designed to span adjacent genes

The frdD gene location relative to other metabolic genes can provide insights into potential co-regulation patterns under different environmental conditions relevant to Salmonella pathogenesis.

How does the expression of frdD differ between aerobic and anaerobic conditions in Salmonella agona?

The frdD gene expression in Salmonella agona shows significant upregulation under anaerobic conditions compared to aerobic environments. This expression pattern reflects the enzyme's role in anaerobic respiration:

  • Under aerobic conditions: Expression is typically repressed by global regulators responding to oxygen availability

  • Under anaerobic conditions: Expression is induced, particularly in the presence of fumarate as a terminal electron acceptor

To quantify these expression differences experimentally:

  • Culture Salmonella agona under strictly controlled aerobic and anaerobic conditions

  • Extract total RNA at multiple time points during growth

  • Perform RT-qPCR targeting frdD with appropriate reference genes

  • Alternatively, conduct RNA-seq analysis to capture the entire transcriptional landscape

  • Validate protein expression through Western blotting using antibodies against the FrdD subunit

Studies of other Salmonella serovars show that strains with enhanced persistence capabilities, such as those involved in recurring outbreaks, may exhibit altered regulation of metabolic genes including those in the frd operon . This suggests potential connections between anaerobic metabolism and environmental persistence.

What are the recommended methods for cloning and expressing recombinant frdD from Salmonella agona?

For successful cloning and expression of recombinant frdD from Salmonella agona, the following methodological approach is recommended:

Cloning Strategy:

  • Design primers with appropriate restriction sites compatible with your expression vector

  • Amplify the frdD gene from genomic DNA using high-fidelity polymerase

  • Clone into an intermediate vector (e.g., pGEM-T Easy) for sequence verification

  • Subclone into an expression vector with appropriate tags (His, GST, etc.)

Expression Systems:

  • E. coli-based expression: Use BL21(DE3) or derivatives for high-level expression

  • Alternative systems: Consider cell-free expression systems if membrane association causes expression difficulties

Optimization Parameters:

  • Test multiple induction conditions (IPTG concentration: 0.1-1.0 mM)

  • Vary expression temperatures (16°C, 25°C, 37°C)

  • Adjust induction timing (early vs. mid-log phase)

  • Consider codon optimization if expression levels are low

Purification Approach:

  • Solubilize membranes using appropriate detergents (DDM, LDAO, etc.)

  • Perform affinity chromatography based on the fusion tag

  • Verify protein identity using mass spectrometry and Western blotting

When expressing a subunit of a multi-protein complex, researchers should consider co-expression with other fumarate reductase subunits (FrdA, FrdB, FrdC) to improve stability and functionality of the recombinant protein.

How can genomic analyses distinguish between persistent and newly introduced strains of Salmonella agona when studying frdD mutations?

Distinguishing between persistent and newly introduced strains of Salmonella agona requires sophisticated genomic analysis, particularly when examining genetic elements like frdD mutations:

SNP-Based Analysis Methodology:

  • Generate high-quality whole genome sequences from multiple isolates using short and long-read technologies

  • Implement reference-based SNP calling using pipelines such as CFSAN SNP Pipeline with appropriate filters to remove variants from recombination or mobile elements

  • Apply SNP density filters (e.g., three or more SNPs in 1000 bp window)

  • Construct phylogenetic trees using maximum likelihood methods to visualize evolutionary relationships

  • Calculate SNP differences between isolates to establish relatedness thresholds

Data Interpretation Framework:

  • Closely related persistent strains typically show minimal SNP differences (≤10 SNPs)

  • Newly introduced strains show greater genetic distance

  • Examination of SNP accumulation rates can establish timeline of divergence

  • Analysis of specific mutations in metabolic genes like frdD can identify adaptive changes

In the case study of Salmonella Agona outbreaks separated by 10 years (1998 and 2008), WGS analysis revealed a mean of only eight SNP differences between outbreak isolates, demonstrating the strain's persistence in the facility rather than a new introduction . This approach outperforms traditional PFGE methods, which could not distinguish between persistent and new strains due to identical PFGE patterns (JABX01.0001) .

For frdD-specific analysis, examine whether mutations are synonymous or non-synonymous and their potential impact on protein function and anaerobic metabolism.

What methodologies are most effective for studying potential associations between frdD variants and antimicrobial resistance in Salmonella agona?

Investigating associations between frdD variants and antimicrobial resistance in Salmonella agona requires integration of genomic, phenotypic, and functional approaches:

Genomic-Phenotypic Correlation Approach:

  • Sequence frdD gene from multiple antimicrobial-resistant and susceptible isolates

  • Perform antimicrobial susceptibility testing using broth microdilution or disk diffusion methods

  • Conduct statistical analyses to identify correlations between specific frdD variants and resistance phenotypes

  • Verify associations through whole-genome sequencing to rule out linkage with known resistance determinants

Plasmid and Mobile Genetic Element Analysis:

  • Characterize plasmids using PCR, Southern hybridization, and sequencing

  • Identify antimicrobial resistance genes co-localized with frdD variants

  • Determine if frdD variants are chromosomal or plasmid-borne

  • Assess potential horizontal gene transfer mechanisms

Functional Validation Experiments:

  • Create isogenic mutants with and without frdD variants

  • Measure MICs against various antimicrobial agents

  • Assess fitness under antibiotic pressure in both aerobic and anaerobic conditions

  • Investigate metabolic changes through respirometry and growth curve analysis

Data Analysis Framework:

Experimental ApproachParameters to MeasureExpected Outcomes for Positive Association
Genomic AnalysisSNP frequency in frdD; Linkage with AMR genesStatistical correlation between specific mutations and resistance
TranscriptomicsExpression levels under antibiotic stressDifferential expression of frdD variants in resistant strains
Mutant StudiesGrowth rates with/without antibioticsAltered fitness costs of resistance in different frdD backgrounds
Biochemical AssaysEnzyme activity with/without antibioticsDirect interaction between FrdD and antimicrobials or indirect effects

Research on multidrug-resistant Salmonella Agona has identified strains harboring multiple plasmid-encoded resistance determinants, including beta-lactamases and aminoglycoside resistance genes . While direct involvement of frdD in resistance mechanisms is not established, alterations in anaerobic metabolism could potentially influence bacterial persistence during antimicrobial therapy.

How can contradictions in experimental data regarding frdD function in Salmonella agona be systematically identified and resolved?

Systematic identification and resolution of contradictions in experimental data regarding frdD function requires structured approaches to data analysis and experimental design:

Contradiction Detection Framework:

  • Implement systematic literature review with predefined inclusion/exclusion criteria

  • Extract methodological details and results into standardized formats

  • Apply formal contradiction detection algorithms similar to those used in other fields

  • Categorize contradictions as: numerical inconsistencies, methodological differences, or interpretation conflicts

Resolution Methodology:

  • Replication Studies:

    • Design experiments controlling for key variables identified in contradictory studies

    • Use standardized protocols across different laboratories

    • Implement blinded analysis to prevent bias

  • Meta-Analysis Approach:

    • Pool raw data from multiple studies when available

    • Utilize statistical methods that account for inter-study heterogeneity

    • Identify moderator variables that may explain divergent results

  • Advanced Analytical Methods:

    • Apply machine learning techniques to identify patterns in contradictory data

    • Create computational models to test hypotheses explaining contradictions

    • Utilize Bayesian approaches to incorporate prior knowledge

Data Reconciliation Process:

Contradiction TypeDetection MethodResolution Approach
Methodological VarianceCompare experimental protocolsStandardize methods or identify protocol-dependent effects
Statistical InconsistenciesReanalyze raw data with consistent methodsDetermine appropriate statistical approaches for data type
Functional InterpretationExamine assumptions in different modelsDevelop unified model that accounts for context-dependent functions
Strain-Specific DifferencesCompare genomic backgroundsCharacterize frdD function across diverse Salmonella agona isolates

When analyzing contradictions, it's essential to distinguish between true contradictions and apparent contradictions resulting from different experimental conditions or genetic backgrounds. For instance, the role of frdD may differ between strains with different antimicrobial resistance profiles or between strains isolated from different outbreaks .

What are the current challenges in structural characterization of Salmonella agona FrdD and how can they be addressed?

The structural characterization of Salmonella agona FrdD presents several significant challenges due to its nature as a membrane-associated protein subunit within a multi-protein complex:

Current Challenges and Solutions:

  • Membrane Protein Crystallization:

    • Challenge: Low expression yields and poor stability outside membrane environment

    • Solutions:

      • Use lipidic cubic phase crystallization techniques

      • Apply detergent screening to identify optimal solubilization conditions

      • Implement nanodiscs or amphipols to maintain native-like environment

      • Consider co-crystallization with stabilizing antibody fragments

  • Structural Heterogeneity:

    • Challenge: FrdD functions as part of a multisubunit complex (FrdABCD)

    • Solutions:

      • Co-express and purify the entire complex

      • Utilize protein engineering to improve complex stability

      • Apply single-particle cryo-EM to capture different conformational states

  • Computational Modeling Limitations:

    • Challenge: Homology modeling may be inaccurate for membrane proteins

    • Solutions:

      • Integrate experimental constraints from crosslinking or hydrogen-deuterium exchange

      • Validate models with site-directed mutagenesis

      • Apply AlphaFold2 or RoseTTAFold with specialized protocols for membrane proteins

Methodological Framework for Structural Studies:

MethodAdvantagesLimitationsData Output
X-ray CrystallographyHigh-resolution structures possibleDifficult for membrane proteinsAtomic coordinates at 1.5-3.0Å
Cryo-EMNo crystallization required; captures statesLower resolution for small proteinsMaps at 2.5-4.0Å resolution
NMR SpectroscopyDynamic information; solution conditionsSize limitationsDistance constraints and dynamics
HDX-MSNo size limitation; probes dynamicsLower resolution structural informationSolvent accessibility patterns
Computational PredictionRapid; requires only sequenceAccuracy varies; requires validationPredicted 3D models

Recent advances in structural biology, particularly in cryo-EM and computational structure prediction, offer promising approaches to overcome these challenges. For instance, incorporating known genetic variations from different Salmonella Agona isolates into structural models could provide insights into strain-specific functional differences that might relate to virulence or persistence capabilities .

What controls should be included when studying the influence of frdD mutations on Salmonella agona persistence?

Genetic Controls:

  • Wild-type parent strain (without frdD mutations)

  • Complemented mutant strain (frdD mutation + plasmid-expressed wild-type frdD)

  • Control mutations in non-respiratory genes

  • Multiple independent mutants with the same frdD mutation to control for second-site mutations

Experimental Design Controls:

  • Time-point sampling strategy that captures both short-term and long-term persistence

  • Multiple environmental conditions mimicking relevant settings (food processing facility surfaces, low-moisture foods, etc.)

  • Competitive index experiments pairing wild-type and mutant strains

  • Inclusion of reference strains with known persistence phenotypes

Analytical Controls:

  • Quantification method validation (limit of detection, linear range, etc.)

  • Technical and biological replicates

  • Statistical analysis appropriate for the data distribution

  • Normalization strategy for comparing across experiments

The persistence of Salmonella Agona in food processing environments, as demonstrated by nearly identical strains causing outbreaks 10 years apart , suggests complex adaptation mechanisms potentially involving metabolic pathways. When studying frdD's role in this persistence, it's crucial to distinguish between genetic drift (random mutations accumulating over time) and selective pressure causing functional adaptations in anaerobic respiration pathways.

How can transcriptomic and proteomic approaches be integrated to study frdD regulation in Salmonella agona under different environmental stresses?

Integrating transcriptomic and proteomic approaches provides a comprehensive understanding of frdD regulation in Salmonella agona under environmental stresses:

Integrated Methodology Framework:

  • Coordinated Experimental Design:

    • Subject identical cultures to environmental stresses (oxygen limitation, nutrient deprivation, desiccation, etc.)

    • Collect paired samples for both transcriptomic and proteomic analysis at multiple time points

    • Include appropriate controls for each condition

  • Transcriptomic Analysis:

    • Perform RNA-seq using strand-specific libraries

    • Quantify frdD mRNA levels and identify potential regulatory RNAs

    • Analyze co-expressed genes to identify regulatory networks

    • Map transcription start sites using techniques like dRNA-seq

  • Proteomic Analysis:

    • Implement LC-MS/MS-based shotgun proteomics

    • Quantify FrdD protein abundance using label-free or labeled approaches

    • Identify post-translational modifications

    • Perform protein-protein interaction studies to map the FrdD interactome

  • Data Integration Strategies:

Integration LevelApproachesExpected Insights
Correlation AnalysisCalculate transcript-protein correlation coefficientsIdentify post-transcriptional regulation
Pathway MappingMap both datasets to metabolic pathwaysReveal coordinated responses to stress
Network AnalysisConstruct gene-protein regulatory networksDiscover regulatory hubs affecting frdD
Time-Series AnalysisDetermine temporal sequence of regulationEstablish causality in regulatory events
  • Validation Experiments:

    • Construct transcriptional reporters (e.g., frdD promoter-GFP fusions)

    • Create translational fusions to quantify protein production

    • Apply CRISPR interference to validate regulatory factor roles

    • Use ChIP-seq to identify transcription factor binding sites

This integrated approach is particularly valuable when studying strains with different persistence capabilities, such as those involved in the 1998 and 2008 Salmonella Agona outbreaks . Differences in transcriptomic and proteomic profiles under stress conditions may explain why certain strains can persist in food processing environments for extended periods.

What are the most reliable methods for assessing the impact of frdD mutations on Salmonella agona virulence?

Assessing the impact of frdD mutations on Salmonella agona virulence requires a multi-faceted approach combining in vitro, ex vivo, and in vivo methodologies:

In Vitro Virulence Assays:

  • Invasion Assays:

    • Infect epithelial cell lines (Caco-2, HT-29) with wild-type and frdD mutants

    • Quantify invasion efficiency through gentamicin protection assay

    • Analyze differences in invasion mechanisms using microscopy

  • Intracellular Survival:

    • Infect macrophage cell lines (RAW264.7, THP-1)

    • Measure survival at multiple time points post-infection

    • Assess inflammasome activation and macrophage responses

  • Biofilm Formation:

    • Quantify biofilm formation on relevant surfaces

    • Evaluate structure using confocal microscopy

    • Assess biofilm resistance to disinfectants

Ex Vivo Systems:

  • Intestinal organoid infection models

  • Precision-cut lung slices for respiratory infection modeling

  • Whole blood killing assays to evaluate resistance to serum components

In Vivo Models:

  • Murine Infection Models:

    • Oral infection to mimic natural route

    • Typhoid fever model (systemic infection)

    • Competitive index experiments with wild-type strain

    • Tissue colonization pattern analysis

  • Galleria mellonella (Wax Moth) Model:

    • Alternative to mammalian models

    • Quantify survival rates and bacterial loads

    • Assess host immune responses

Molecular Pathogenesis Assessment:

ParameterMethodologyRelevance to frdD Function
Metabolic AdaptationTranscriptomics in host-like conditionsRole in anaerobic niche adaptation
ROS/RNS ResistanceSurvival assays with oxidative/nitrosative stressConnection to electron transport chain
SPI-1/SPI-2 ExpressionReporter constructs, qRT-PCRImpact on virulence gene regulation
In vivo Competitive IndexMixed infections with barcoded strainsDirect measure of fitness in host

How can inconsistent results in recombinant Salmonella agona FrdD purification be diagnosed and resolved?

Inconsistent results in recombinant Salmonella agona FrdD purification can arise from multiple sources. Here's a systematic approach to diagnose and resolve these issues:

Diagnostic Framework:

  • Expression Analysis:

    • Verify expression levels through Western blotting

    • Check for inclusion body formation using microscopy and fractionation

    • Analyze protein solubility in different detergents and buffers

    • Confirm correct protein size by SDS-PAGE

  • Purification Process Evaluation:

    • Implement small-scale purification trials before scaling up

    • Track protein through each purification step with activity assays and Western blots

    • Quantify yield and purity at each step

    • Analyze batch-to-batch variation in starting material

  • Protein Quality Assessment:

    • Verify protein identity using mass spectrometry

    • Assess aggregation status using dynamic light scattering

    • Evaluate protein stability at different temperatures and pH conditions

    • Check for post-translational modifications

Troubleshooting Decision Tree:

ProblemDiagnostic ApproachSolution Strategies
Low ExpressionWestern blot analysis; mRNA quantificationOptimize codon usage; alter promoter strength; change expression strain
Poor SolubilityDetergent screening; solubility tagsTest different detergents (DDM, LDAO); use solubility-enhancing fusion partners
Co-purifying ContaminantsSDS-PAGE; mass spectrometryImplement additional purification steps; optimize wash conditions
Protein InstabilityThermal shift assays; size-exclusion chromatographyAdd stabilizing agents; optimize buffer conditions; co-express with other Frd subunits
Loss of ActivityEnzymatic assaysPreserve native structure with mild purification conditions; maintain reducing environment

Implementation Strategies:

  • Establish a standardized protocol with detailed documentation of each step

  • Create a quality control checklist for each purification batch

  • Implement DOE (Design of Experiments) approach to systematically optimize conditions

  • Consider co-expression with other fumarate reductase subunits to improve stability

When purifying membrane proteins like FrdD, particular attention should be paid to maintaining the protein in a native-like environment throughout the purification process. The experience from characterizing multidrug-resistant Salmonella Agona suggests that protein characterization methodologies need rigorous controls and standardization .

What are the best practices for analyzing contradictions in sequencing data when studying frdD polymorphisms across Salmonella agona isolates?

When analyzing frdD polymorphisms across Salmonella agona isolates, researchers often encounter contradictions in sequencing data. Implementing best practices for contradiction resolution is essential:

Pre-analysis Quality Control:

  • Implement rigorous sequence quality filtering (Q-score thresholds, read length requirements)

  • Perform adapter trimming and low-quality base removal

  • Check for contamination using tools like Kraken2

  • Assess sequencing depth and coverage uniformity across the target region

Variant Calling Best Practices:

  • Use multiple variant calling algorithms and compare results (e.g., GATK, FreeBayes, VarScan)

  • Apply appropriate filters for strand bias, mapping quality, and read depth

  • Implement variant quality score recalibration when possible

  • Validate calls through alternative methods (Sanger sequencing, digital PCR)

Contradiction Resolution Framework:

Contradiction TypeDetection MethodResolution Approach
Technical ArtifactsStrand bias analysis; quality metricsResequence with alternative technology
Mixed PopulationsAllele frequency distribution analysisSingle-colony isolation; deep sequencing
Alignment ErrorsManual inspection of read alignmentsUse alternative aligners; local realignment
Assembly DiscrepanciesCompare multiple assembly algorithmsReference-guided assembly with multiple references

Specific Approaches for frdD Analysis:

  • Sequence the entire frd operon to capture contextual information

  • Compare against multiple reference genomes to avoid reference bias

  • Implement SNP density filtering (3+ SNPs in 1000bp window) to identify recombination regions

  • Distinguish between synonymous and non-synonymous variations

When studying persistent strains like those in the 1998 and 2008 Salmonella Agona outbreaks, it's essential to distinguish true genetic changes from sequencing artifacts. The low number of SNP differences between outbreak isolates (mean of eight SNPs) indicates that even small numbers of variants can be biologically significant, making accurate variant calling critical.

How can researchers validate functional predictions for novel frdD variants identified in Salmonella agona isolates?

Validating functional predictions for novel frdD variants requires a comprehensive approach that combines computational prediction, genetic manipulation, and functional assays:

Computational Prediction Validation:

  • Apply multiple prediction algorithms (SIFT, PolyPhen-2, PROVEAN) and assess consensus

  • Generate structural models using AlphaFold2 or homology modeling to visualize variant impacts

  • Perform molecular dynamics simulations to assess effects on protein stability

  • Use evolutionary conservation analysis to determine if variants affect conserved residues

Genetic Engineering Approaches:

  • Create isogenic strains differing only in frdD variants using allelic exchange

  • Develop complementation systems with wild-type and variant frdD

  • Implement CRISPR-Cas9 base editing for precise introduction of variants

  • Create mutation libraries to study multiple variants simultaneously

Functional Assessment Matrix:

Functional AspectAssay TypeExpected Outcome for Functional Impact
Protein ExpressionWestern blot; qRT-PCRAltered expression levels compared to wild-type
Protein StabilityPulse-chase; thermal shift assaysReduced half-life or thermal stability
Complex FormationBN-PAGE; co-immunoprecipitationAltered interaction with other Frd subunits
Enzymatic ActivityFumarate reduction assaysChanged kinetic parameters (Km, Vmax)
Growth PhenotypesAnaerobic growth curvesImpaired growth with fumarate as terminal electron acceptor
Stress ResistanceSurvival under oxidative/nitrosative stressAltered sensitivity compared to wild-type

Validation in Relevant Conditions:

  • Test under conditions mimicking food processing environments

  • Evaluate persistence capabilities in desiccation models

  • Assess performance in cell culture infection models

  • Validate in animal models when appropriate

When validating frdD variants, it's important to consider the ecological context in which they were identified. Variants found in persistent strains like those in the 1998 and 2008 Salmonella Agona outbreaks may confer advantages specific to food processing environments, while variants in clinical isolates with antimicrobial resistance might have different functional implications.

What are the emerging approaches for studying frdD function in the context of Salmonella agona pathogenesis and persistence?

Emerging approaches for studying frdD function in Salmonella agona are expanding our understanding of its role in pathogenesis and persistence. These cutting-edge methodologies offer new insights into this important metabolic component:

Advanced Genomic Approaches:

  • Single-cell genomics to capture population heterogeneity

  • Long-read sequencing technologies for complete operon and regulatory region characterization

  • Adaptive laboratory evolution followed by genomic analysis to identify adaptive mutations

  • Transposon-sequencing (Tn-seq) to determine genetic interactions with frdD

Systems Biology Integration:

  • Multi-omics approaches combining genomics, transcriptomics, proteomics, and metabolomics

  • Flux balance analysis to model the impact of frdD variants on metabolic networks

  • Network analysis to position FrdD within global regulatory networks

  • Integrative computational modeling of anaerobic metabolism

Novel Functional Approaches:

TechniqueApplication to frdD ResearchPotential Insights
CRISPRiTunable repression of frdD expressionDose-dependent phenotypes without complete gene deletion
OptogeneticsLight-controlled regulation of frdD expressionTemporal regulation studies
BiosensorsReal-time monitoring of fumarate reductase activityIn vivo activity dynamics
MicrofluidicsSingle-cell analysis of frdD expressionHeterogeneity in bacterial populations

Translational Research Directions:

  • Development of inhibitors targeting FrdD as potential antimicrobials

  • Creation of biosensors for early detection of persistent Salmonella in food processing environments

  • Engineering of attenuated vaccine strains with modified frdD

The study of persistent Salmonella Agona strains causing outbreaks separated by a decade demonstrates the importance of understanding metabolic adaptations in environmental persistence. Future research should focus on determining whether specific frdD variants contribute to this persistence and how anaerobic metabolism influences survival in food processing environments. Additionally, the connection between antimicrobial resistance and metabolic adaptations, as seen in multidrug-resistant Salmonella Agona , presents an important area for further investigation.

How might contradictions in the current literature on Salmonella agona frdD be reconciled through integrated research approaches?

Contradictions in the current literature on Salmonella agona frdD can be reconciled through integrated research approaches that combine multiple methodologies and perspectives:

Unified Experimental Framework:

  • Establish standardized experimental conditions and strains

  • Create a consensus set of methodologies for frdD characterization

  • Implement multi-laboratory validation studies

  • Develop shared data repositories with raw data availability

Contradiction Resolution Pipeline:

  • Systematically catalog contradictory findings using structured literature review

  • Apply formal contradiction detection methods similar to those used in other fields

  • Design targeted experiments specifically addressing points of contradiction

  • Implement meta-analysis techniques to integrate disparate datasets

Integrative Resolution Strategies:

Contradiction TypeIntegration ApproachExpected Outcome
Methodological DiscrepanciesCross-validation with multiple methodsConsensus methodology recommendations
Strain-Specific DifferencesComparative genomics and phenotypingClassification of strain-dependent effects
Regulatory Context VariationsSystems biology modelingUnified model with condition-specific modules
Functional InterpretationComprehensive mutant characterizationRefined understanding of multifunctional aspects

Community-Based Approaches:

  • Establish research consortia focused on standardization

  • Develop shared resources (strain collections, protocols, data)

  • Implement open science practices with pre-registration of studies

  • Create integrated databases for Salmonella functional genomics

The reconciliation of contradictions requires acknowledging the complex nature of bacterial metabolism and its context-dependency. The experience from studying Salmonella Agona outbreaks shows that integrating multiple analytical approaches (genomics, epidemiology, phenotypic testing) provides a more complete understanding than any single approach . Similarly, understanding frdD function will likely require integration of structural, functional, genomic, and ecological perspectives.

By implementing these integrated approaches, researchers can move beyond contradictions to develop a unified model of frdD function in Salmonella agona that accounts for strain variation, environmental context, and methodological differences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.