Recombinant Salmonella agona Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
plsY; ygiH; SeAg_B3393; Glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
plsY
Target Protein Sequence
MSAIAPGMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGATNVLRIGGKGAAVAVLI FDILKGMLPVWGAYALGVTPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKLKKKRQKD
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-ACP or acyl-CoA (though less efficiently with the latter) to glycerol-3-phosphate (G3P), yielding lysophosphatidic acid (LPA). It does not utilize acyl-PO4 as a fatty acyl donor.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Glycerol-3-phosphate acyltransferase (plsY) in Salmonella agona?

Glycerol-3-phosphate acyltransferase (plsY) in Salmonella agona functions as an integral membrane protein catalyzing a critical step in bacterial phospholipid biosynthesis. Specifically, plsY transfers an acyl group from acylphosphate to glycerol-3-phosphate (G3P), forming lysophosphatidic acid, a precursor for membrane phospholipid synthesis. This reaction represents the most widely distributed pathway for initiating phosphatidic acid formation in bacterial membranes. The process begins with the conversion of acyl-acyl carrier protein to acylphosphate by another enzyme called PlsX, followed by the PlsY-mediated transfer of the acyl group to G3P. This two-step enzymatic process is fundamental to bacterial membrane biogenesis and constitutes a potential target for antimicrobial development.

What are the structural characteristics of Salmonella agona plsY protein?

Salmonella agona plsY is characterized by its unique membrane topology consisting of five membrane-spanning segments. The protein's amino terminus and two short loops are positioned on the external face of the bacterial membrane, while three larger cytoplasmic domains contain highly conserved sequence motifs critical for catalytic function. The full amino acid sequence of plsY (UniProt accession: B5F6A3) includes approximately 203 amino acids. The protein contains three functionally significant motifs: Motif 1 with essential serine and arginine residues necessary for catalysis; Motif 2 exhibiting characteristics of a phosphate-binding loop crucial for glycerol-3-phosphate interaction; and Motif 3 containing conserved histidine and asparagine residues important for activity, along with a glutamate that maintains structural integrity.

How is recombinant Salmonella agona plsY typically stored and handled in laboratory settings?

Recombinant Salmonella agona plsY requires specific storage and handling protocols to maintain structural integrity and enzymatic activity. The protein is typically stored in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for plsY stability. For long-term storage, the protein should be kept at -20°C or -80°C for extended preservation. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they may compromise protein stability and activity. When preparing experimental samples, researchers should create single-use aliquots to prevent degradation from multiple freezing and thawing events. The glycerol content in the storage buffer helps prevent ice crystal formation that could disrupt protein structure during freezing.

What are the alternative names and enzyme classification details for plsY?

Salmonella agona plsY is known by several alternative names and classifications in scientific literature and databases. Its recommended full name is Glycerol-3-phosphate acyltransferase, but it is also commonly referred to as G3P acyltransferase or abbreviated as GPAT. Additionally, it is known as Lysophosphatidic acid synthase or LPA synthase, reflecting its role in producing lysophosphatidic acid. Enzymatically, plsY is classified under EC 2.3.1.15 and EC 2.3.1.n5, denoting its function as an acyltransferase. In genomic databases, the gene is designated as plsY with ygiH as a synonym. In Salmonella agona strain SL483, the gene has the ordered locus name SeAg_B3393. Understanding these alternative designations is essential for comprehensive literature searches and database queries when researching this enzyme.

What experimental approaches are most effective for assessing plsY enzymatic activity in vitro?

Assessing plsY enzymatic activity in vitro requires careful experimental design that accounts for its integral membrane nature and specific substrate requirements. The most effective approach involves a coupled enzymatic assay that measures the transfer of acyl groups from acylphosphate to glycerol-3-phosphate. Researchers should first prepare membrane fractions containing recombinant plsY or purify the protein using detergent solubilization followed by affinity chromatography. The enzymatic reaction can be monitored by tracking either the consumption of acylphosphate or the formation of lysophosphatidic acid. For quantitative analysis, radiolabeled substrates (such as 14C-labeled glycerol-3-phosphate) can be employed, followed by lipid extraction and thin-layer chromatography or HPLC separation. Alternatively, a coupled spectrophotometric assay can be developed to measure reaction progress. It's crucial to control reaction conditions including pH (typically 7.0-7.5), temperature (30-37°C), and ionic strength. Researchers must also consider the noncompetitive inhibition by palmitoyl-CoA when designing kinetic experiments with plsY.

How do mutations in the conserved motifs of plsY affect its catalytic function?

Site-directed mutagenesis studies have revealed that each of the three conserved motifs in plsY plays a critical role in its catalytic function, with specific amino acid residues contributing uniquely to enzyme activity. In Motif 1, mutation of the conserved serine or arginine residues leads to complete loss of enzymatic activity, indicating their essential role in catalysis, possibly in acyl group recognition or transfer. In Motif 2, which exhibits characteristics of a phosphate-binding loop, mutations of conserved glycine residues to alanines result in a significant increase in the Km value for glycerol-3-phosphate, confirming this motif's role in substrate binding. The Km defect suggests altered substrate affinity without necessarily affecting catalytic turnover. In Motif 3, mutations of the conserved histidine and asparagine residues substantially reduce catalytic activity, while alteration of the conserved glutamate residue destabilizes the entire protein structure. These structure-function relationships provide valuable insights for rational design of inhibitors targeting specific functional domains of plsY.

What are the differences in glycerol-3-phosphate transport mechanisms between Salmonella strains and how might this affect plsY function?

Glycerol-3-phosphate transport mechanisms show notable variations between Salmonella strains, which may significantly impact substrate availability for plsY. Salmonella typhimurium contains an inducible transport system for sn-glycerol-3-phosphate (G3P) that is activated by growth on glycerol and G3P. In fully induced cells, this system exhibits an apparent Km of approximately 50 μM and a Vmax of 2.2 nmol/min per 10^8 cells, differing from the Escherichia coli system which shows a lower Km of 14 μM with the same Vmax under comparable conditions. This difference in affinity could affect intracellular G3P concentrations available to plsY. Additionally, Salmonella strains possess a secondary ugp-dependent transport system for G3P that becomes derepressed under phosphate starvation conditions. Researchers investigating plsY function must consider these strain-specific transport variations when designing experiments, particularly when comparing plsY activity across different bacterial species or when studying plsY in heterologous expression systems. The availability of G3P as a substrate may become a rate-limiting factor for plsY activity under certain growth conditions or genetic backgrounds.

How can recombinant plsY be optimally expressed and purified for structural studies?

Optimal expression and purification of recombinant plsY for structural studies presents significant challenges due to its integral membrane nature and requires a specialized approach. Based on successful strategies used for similar membrane proteins, researchers should consider expression in E. coli systems using vectors like pACYC184 that allow for controlled overexpression. The addition of an affinity tag (such as His6 or FLAG) at either terminus should be evaluated for minimal interference with folding and function. Expression should be conducted at lower temperatures (16-20°C) to facilitate proper membrane integration and folding. For purification, a two-step detergent solubilization process is recommended: initial membrane isolation by ultracentrifugation followed by solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG). Affinity chromatography followed by size exclusion chromatography in the presence of detergent micelles will yield highly pure protein. For structural studies, detergent screening or reconstitution into nanodiscs or lipid cubic phase may be necessary. Quality control should include activity assays and protein stability assessment using thermal shift assays before proceeding to crystallization trials or cryo-EM grid preparation.

What role might plsY play in Salmonella agona persistence during infection?

The role of plsY in Salmonella agona persistence during infection represents an important frontier in understanding bacterial adaptation during host colonization. Phospholipid biosynthesis enzymes like plsY may contribute to persistence by facilitating membrane remodeling in response to host environments. During the transition from acute to persistent infection, S. agona undergoes genomic and phenotypic changes, including potential alterations in membrane composition that could involve modulated plsY activity. Recent phylogenomic analyses of S. agona isolates from acute and persistent infections have revealed increased SNP variation during early convalescent carriage (3 weeks to 3 months post-infection), suggesting population expansion or selection during establishment of persistence. Although specific mutations in plsY have not been directly identified in these studies, the enzyme's central role in membrane biogenesis makes it a candidate for adaptation. Researchers investigating this relationship should consider comparative analyses of plsY expression and activity between acute and persistent isolates, membrane lipid profiling under various infection-relevant conditions, and targeted mutations in plsY to assess impacts on persistence in animal models. Additionally, the potential role of plsY in biofilm formation, which often contributes to bacterial persistence, warrants investigation.

What controls should be included when studying recombinant plsY activity?

When studying recombinant plsY activity, several critical controls must be incorporated to ensure experimental validity and accurate interpretation of results. Negative controls should include: (1) heat-inactivated enzyme preparations to establish baseline readings for non-enzymatic reactions; (2) reactions lacking individual substrates (acylphosphate or glycerol-3-phosphate) to confirm substrate specificity; and (3) detergent-only controls when working with purified protein to account for potential detergent effects on assay readouts. Positive controls should include: (1) well-characterized acyltransferases with similar activities when available; (2) complementation assays in plsY-deficient bacterial strains to confirm functionality; and (3) standardized enzyme preparations of known activity for inter-assay normalization. Additionally, researchers should implement substrate concentration controls to ensure operation within the linear range of the enzyme, and include palmitoyl-CoA at varying concentrations to account for its noncompetitive inhibitory effect. Time course analyses should also be performed to establish reaction linearity. When testing potential inhibitors, researchers should include specificity controls using unrelated enzymes to rule out non-specific effects.

How can researchers differentiate between the catalytic functions of plsY and other acyltransferases in Salmonella?

Differentiating between the catalytic functions of plsY and other acyltransferases in Salmonella requires a multi-faceted experimental approach that exploits the unique characteristics of each enzyme. The most definitive method involves genetic approaches, creating knockout mutants for individual acyltransferase genes and assessing the specific acyltransferase activities that are lost. For biochemical discrimination, researchers should capitalize on plsY's distinct preference for acylphosphate as the acyl donor, in contrast to other acyltransferases that typically utilize acyl-CoA or acyl-ACP. Substrate specificity assays using various acyl donors (acylphosphate, acyl-CoA, acyl-ACP) and acceptors (glycerol-3-phosphate, lyso-phospholipids) can clearly distinguish plsY activity. Additionally, plsY's unique inhibition profile by palmitoyl-CoA (noncompetitive inhibition) provides another distinguishing characteristic. Immunological approaches using specific antibodies against plsY can be employed for activity depletion studies. Finally, recombinant expression of individual acyltransferases in heterologous systems lacking endogenous acyltransferase activity allows direct assessment of specific enzyme functions. Researchers should also consider the membrane localization of plsY versus potential cytosolic localization of other acyltransferases when designing fractionation experiments.

What bioinformatic approaches are most valuable for studying plsY homologs across bacterial species?

Studying plsY homologs across bacterial species benefits from several sophisticated bioinformatic approaches that can reveal evolutionary relationships and functional conservation. Sequence-based methods should begin with position-specific iterative BLAST (PSI-BLAST) searches to identify distant homologs, followed by multiple sequence alignment using MUSCLE or MAFFT algorithms optimized for membrane proteins. These alignments can reveal conservation patterns in the three key motifs of plsY and identify species-specific variations. Phylogenetic analysis using maximum likelihood methods (RAxML or IQ-TREE) can help establish evolutionary relationships between plsY homologs and potential functional divergence. Structure prediction tools specific for membrane proteins, such as AlphaFold-Multimer or MEMOIR, should be employed to model putative homologs and analyze conservation of structural features. Genomic context analysis is particularly valuable, examining the organization of plsY relative to other phospholipid biosynthesis genes like plsX across species. For functional prediction, researchers should utilize specialized tools like InterPro and Pfam to identify conserved domains, combined with coevolution analysis to predict residue interactions. Finally, transcriptomic data integration can provide insights into expression patterns of plsY homologs under various conditions across bacterial species.

What comparative analyses can reveal insights about plsY function in different Salmonella strains?

Comparative analyses across different Salmonella strains can yield valuable insights into plsY function and adaptation. Researchers should implement a multi-level comparative approach beginning with sequence analysis to identify strain-specific amino acid substitutions, particularly within the three conserved catalytic motifs. These sequence variations should be mapped onto structural models to predict functional implications. Expression level comparison using RT-qPCR or RNA-seq data can reveal differential regulation of plsY across strains, particularly under infection-relevant conditions. Enzymatic activity comparisons using standardized assay conditions can identify strain-specific kinetic parameters (Km, Vmax) and inhibition profiles. Membrane lipid composition analysis using lipidomic approaches can connect plsY activity variations to differences in phospholipid profiles between strains. For in vivo relevance, comparison of plsY deletion mutants across strains in infection models can highlight strain-specific dependencies on this enzyme. Additionally, researchers should examine potential epistatic interactions by comparing the effects of plsY mutations in the genetic backgrounds of different strains. Finally, evolutionary analysis of selection pressure on plsY across the Salmonella genus can identify positively selected residues that may contribute to strain-specific adaptations in phospholipid metabolism.

How can structural data from plsY be leveraged for antimicrobial development?

Structural data from plsY provides a valuable foundation for antimicrobial development targeting this essential bacterial enzyme. Researchers should employ structure-based drug design approaches focusing on the three conserved motifs that are critical for catalytic function. Virtual screening campaigns should target the glycerol-3-phosphate binding site (Motif 2) or the catalytic residues in Motifs 1 and 3, using the structural models to identify potential binding pockets. Fragment-based drug discovery approaches can identify chemical scaffolds with affinity for these sites. Molecular dynamics simulations can reveal transient binding pockets and conformational changes during catalysis that might be exploited for inhibitor design. When developing potential inhibitors, researchers should consider the membrane-embedded nature of plsY, prioritizing compounds with appropriate lipophilicity for membrane penetration while maintaining aqueous solubility. The evolutionary conservation of plsY across bacterial species should be leveraged to develop broad-spectrum agents, while structural differences between bacterial and human acyltransferases must be exploited to ensure selectivity and minimize toxicity. Researchers should establish clear structure-activity relationships through systematic modification of lead compounds and correlate binding modes with inhibitory potency using enzyme assays and bacterial growth inhibition studies. Finally, resistance potential should be assessed through directed evolution experiments to identify possible resistance mutations in plsY.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.