Recombinant Salmonella agona Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mscL; SeAg_B3606; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
mscL
Target Protein Sequence
MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEE VLLGEIRDLLKEQNNRS
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Salmonella agona MscL protein and what is its primary function?

The Large-conductance mechanosensitive channel (MscL) in Salmonella agona is a membrane protein that functions as a pressure-relief valve to protect bacterial cells during osmotic downshock. The channel opens in response to increased membrane tension, allowing the rapid efflux of cytoplasmic solutes to prevent cell lysis . As a mechanosensitive channel, it transduces mechanical force into an electrochemical response, playing a crucial role in bacterial osmoregulation. The full-length protein consists of 137 amino acids and forms a homopentameric structure within the bacterial membrane.

What are the optimal storage and reconstitution conditions for recombinant MscL protein?

For optimal preservation of recombinant Salmonella agona MscL protein:

ParameterRecommendation
Storage temperature-20°C to -80°C
AliquotingNecessary to avoid repeated freeze-thaw cycles
Storage bufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Glycerol addition5-50% final concentration (50% recommended)

When reconstituting the lyophilized protein, brief centrifugation is recommended prior to opening the vial to ensure all material is at the bottom . After reconstitution, the protein should be aliquoted to avoid repeated freeze-thaw cycles, which can compromise structural integrity and functional activity.

What expression systems are commonly used for producing recombinant Salmonella agona MscL?

Escherichia coli is the most widely used expression system for producing recombinant Salmonella agona MscL protein . This heterologous expression system provides several advantages:

  • High protein yield and cost-effectiveness

  • Genetic similarity between E. coli and Salmonella allowing proper protein folding

  • Well-established protocols for membrane protein expression

  • Compatibility with various fusion tags (particularly N-terminal His-tags)

  • Established purification methods for membrane proteins

When expressing MscL in E. coli, researchers typically optimize codon usage, induction conditions, and membrane fraction isolation to maximize functional protein yield.

How can researchers verify the purity and functionality of recombinant MscL preparations?

Verification of recombinant Salmonella agona MscL purity and functionality involves multiple analytical approaches:

  • Purity assessment:

    • SDS-PAGE (>90% purity is typically acceptable for most applications)

    • Western blotting using anti-His antibodies to confirm tag presence

    • Size-exclusion chromatography to evaluate homogeneity

  • Functionality verification:

    • Patch-clamp electrophysiology to measure channel conductance

    • Reconstitution into liposomes and pressure-induced dye release assays

    • Circular dichroism to confirm proper secondary structure

    • Osmotic downshock survival assays in MscL-deficient bacterial strains

These complementary approaches ensure both the structural integrity and functional capacity of the recombinant protein.

How might MscL contribute to Salmonella agona persistence during infection?

Recent phylogenomic research on Salmonella agona reveals potential connections between mechanosensitive responses and bacterial persistence. During the transition from acute to persistent infection, S. agona exhibits increased genomic variation, including SNPs and genomic structural changes . This genomic plasticity may involve alterations in membrane protein expression and function, including MscL.

Mechanosensitive channels like MscL could contribute to persistence through:

  • Adaptation to osmotic stress within host phagocytes

  • Protection from membrane stress during transition between host environments

  • Potential involvement in biofilm formation, which decreases during convalescent and temporary carriage stages

  • Contribution to altered metabolic states associated with persistent infection

Researchers investigating S. agona persistence should consider examining MscL expression levels and potential mutations across different infection stages, particularly during the critical transition period when genomic structural variations increase .

What experimental approaches are optimal for assessing MscL channel gating properties?

To comprehensively characterize MscL channel gating properties in Salmonella agona, researchers should employ a multi-modal approach:

TechniqueInformation ObtainedAdvantagesLimitations
Patch-clamp electrophysiologySingle-channel conductance, gating kinetics, tension sensitivityDirect measurement of channel activityTechnical difficulty, low throughput
Fluorescence-based liposome assaysPopulation-level channel activationHigher throughput, simpler setupIndirect measurement of activity
Atomic force microscopyMechanical properties of channels in membraneDirect visualization of structural changesSpecialized equipment required
Molecular dynamics simulationsAtomistic gating mechanism predictionsDetailed structural insightsComputational limitations, validation needed

For patch-clamp experiments, researchers can reconstitute purified MscL into azolectin liposomes and form giant unilamellar vesicles (GUVs) for patch recordings. Negative pressure applied through the patch pipette induces membrane tension, allowing quantification of pressure thresholds for channel opening.

For fluorescence-based assays, MscL can be reconstituted into liposomes loaded with self-quenching fluorescent dyes. Upon channel opening, dye release results in fluorescence increase, providing a quantitative readout of channel activity across populations.

How does the structure-function relationship of Salmonella agona MscL compare with other bacterial species?

The MscL protein is highly conserved across bacterial species, with the Salmonella agona variant belonging to the same structural family as the well-characterized E. coli and M. tuberculosis MscL proteins. Comparative analysis reveals:

  • The Salmonella agona MscL consists of 137 amino acids, forming a homopentameric structure with two transmembrane domains per subunit

  • The transmembrane helices TM1 and TM2 form the core channel structure, with TM1 lining the pore

  • The conserved constriction point consists of hydrophobic amino acids (particularly leucine and valine residues) that create the channel gate

Researchers interested in the structural basis of MscL function should consider site-directed mutagenesis of key residues identified through sequence alignment to determine Salmonella-specific functional adaptations.

What role might MscL play in Salmonella agona biofilm formation and antibiotic resistance?

While direct evidence linking MscL to biofilm formation in Salmonella agona is limited, mechanistic connections can be hypothesized based on related research:

Recent studies on S. agona persistence indicate that isolates from patients with convalescent and temporary carriage show significantly reduced biofilm formation compared to isolates from patients with acute illness . This observation suggests biofilm capacity changes during infection progression.

MscL may influence biofilm formation through:

  • Mechanosensing within biofilm microenvironments: Biofilms create heterogeneous osmotic and mechanical stress conditions where MscL function could be critical

  • Stress response integration: MscL activation may trigger downstream signaling affecting biofilm-associated genes

  • Antibiotic tolerance: MscL channel opening in response to membrane-targeting antibiotics could reduce their efficacy, potentially contributing to the antibiotic tolerance observed in biofilm-associated infections

  • Potential interaction with biofilm-related genes: Although MscL is not directly mentioned among the key biofilm-formation genes like rpoS, invA, and fliC , it may function in the same regulatory networks

Research examining MscL expression levels in S. agona isolates with varying biofilm capacities could reveal previously unrecognized connections between mechanosensing and bacterial persistence.

How can site-directed mutagenesis of the MscL protein inform our understanding of channel function?

Site-directed mutagenesis of Salmonella agona MscL provides powerful insights into channel function, gating mechanisms, and potential drug targets. Based on the amino acid sequence provided , researchers should consider:

Target RegionAmino Acid PositionsMutagenesis StrategyExpected Outcome
Channel gate21-26 (GVIIGA)Substitution of hydrophobic residues with hydrophilic onesAltered gating tension threshold
Transmembrane helices15-36 (TM1), 69-89 (TM2)Conservative and non-conservative substitutionsChanges in channel conductance and ion selectivity
Cytoplasmic domain110-137Truncation or charge alterationsModified channel clustering or activation kinetics
N-terminal region1-14Alanine scanningIdentification of regions involved in tension sensing

When designing mutagenesis experiments, researchers should:

  • Create single-point mutations at conserved residues first to establish baseline effects

  • Progress to more complex mutations based on initial results

  • Utilize multiple functional assays to comprehensively characterize each mutant

  • Compare results with known mutations in other bacterial species to identify Salmonella-specific properties

This systematic approach will generate a comprehensive structure-function map of the Salmonella agona MscL, potentially revealing novel therapeutic targets.

What are the key considerations for incorporating recombinant MscL into artificial membrane systems?

Successful incorporation of recombinant Salmonella agona MscL into artificial membrane systems requires careful optimization of multiple parameters:

  • Lipid composition:

    • Phosphatidylethanolamine (PE) and phosphatidylglycerol (PG) mixtures approximate bacterial membrane composition

    • Membrane thickness impacts channel function (thicker membranes increase gating tension)

    • Consider adding cardiolipin to mimic bacterial membrane domains

  • Protein-to-lipid ratio:

    • Start with 1:200 to 1:500 protein-to-lipid molar ratios

    • Optimize based on specific application (higher ratios for structural studies, lower for single-channel recordings)

  • Reconstitution method selection:

    • Detergent-mediated reconstitution using mild detergents (DDM, Triton X-100)

    • Direct incorporation during liposome formation

    • Gentle hydration versus extrusion methods based on vesicle size requirements

  • Buffer considerations:

    • Maintain pH between 7.0-8.0

    • Include 150-300 mM KCl or NaCl for physiological ionic strength

    • Consider adding sucrose or trehalose (6%) for stabilization

  • Quality control metrics:

    • Size distribution analysis of proteoliposomes

    • Orientation analysis of incorporated channels

    • Functional verification via dye release assays

These parameters should be systematically optimized based on the specific experimental objectives and readout methodologies.

How can researchers quantitatively assess MscL expression during different phases of Salmonella infection?

Quantitative assessment of MscL expression throughout the infection cycle requires both in vitro and in vivo approaches:

In vitro methods:

  • Quantitative RT-PCR:

    • Design primers specific to Salmonella agona mscL gene

    • Normalize expression to housekeeping genes (rpoD, gyrB)

    • Compare expression across different growth phases and stress conditions

  • Western blot analysis:

    • Generate specific antibodies against Salmonella MscL or use anti-His antibodies for tagged versions

    • Use membrane fraction preparations to enrich the target protein

    • Quantify band intensity relative to total membrane protein

In vivo/ex vivo methods:

  • Infection model sampling:

    • Isolate bacteria from different infection stages (acute, convalescent, persistent)

    • Immediately preserve RNA for transcriptional analysis

    • Use rapid fractionation protocols to minimize expression changes

  • Reporter gene fusions:

    • Create transcriptional/translational fusions with fluorescent proteins

    • Monitor expression dynamics in real-time during infection

    • Correlate with observed phenotypes (e.g., biofilm formation capacity)

This multi-modal approach can reveal how MscL expression patterns correlate with the transition from acute to persistent infection, potentially identifying critical regulation points that could be therapeutically targeted.

What analytical techniques are recommended for studying MscL interactions with other membrane components?

To characterize MscL interactions with other membrane components, researchers should employ complementary approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-His antibodies to pull down His-tagged MscL

    • Identify interacting partners by mass spectrometry

    • Verify interactions with candidate proteins using reverse Co-IP

  • Förster Resonance Energy Transfer (FRET):

    • Label MscL and potential interaction partners with appropriate fluorophore pairs

    • Measure FRET efficiency in reconstituted membranes

    • Use acceptor photobleaching to confirm specific interactions

  • Chemical cross-linking:

    • Apply membrane-permeable cross-linkers to intact cells

    • Isolate MscL complexes and identify cross-linked partners by mass spectrometry

    • Use variable-length cross-linkers to map interaction distances

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein fragments fused to MscL and candidate partners

    • Reconstitution of fluorescence indicates proximity in the membrane

    • Allows visualization of interactions in living cells

  • Microscale Thermophoresis (MST):

    • Measure binding affinities between purified MscL and interaction candidates

    • Requires minimal sample amounts and works in native-like environments

    • Can detect weak transient interactions common in membrane protein complexes

These methods can reveal how MscL interacts with other proteins and lipids, potentially uncovering connections to persistence mechanisms observed in Salmonella agona infections .

How might genomic structural variations in persistent Salmonella agona infections impact MscL expression and function?

Recent phylogenomic analysis of Salmonella agona isolates revealed significant genomic structural variations (GSs) during persistent infections . These genomic rearrangements could impact MscL expression and function in several ways:

  • Potential regulatory changes:

    • GSs were typically associated with early convalescent carriage (3 weeks to 3 months)

    • Such rearrangements could alter promoter regions or introduce new regulatory elements affecting mscL expression

    • Changes in DNA supercoiling resulting from GSs may indirectly affect mscL transcription

  • Genomic context alterations:

    • Of 207 isolates analyzed, 12 showed rearranged genomic structures (beyond the conserved GS1.0 arrangement)

    • Such rearrangements could reposition the mscL gene relative to other genetic elements

    • New genomic neighborhoods might introduce novel co-regulatory relationships

  • SNP accumulation patterns:

    • Increased SNP variation was observed during early persistent infection

    • If SNPs occur within the mscL coding region, they could produce functional variants with altered gating properties

    • Mutations in regulatory regions could change expression patterns

These genomic changes likely represent bacterial adaptation mechanisms during the transition to persistence, potentially involving altered mechanosensing capabilities. Future research should specifically examine whether mscL sequence or expression changes correlate with the documented genomic rearrangements.

What novel methodologies are emerging for studying MscL function in whole cells?

Emerging methodologies for studying MscL function in intact cells include:

  • Microfluidic single-cell analysis:

    • Rapid osmotic shock delivery with precise temporal control

    • Simultaneous imaging of cellular responses

    • High-throughput phenotypic screening of MscL variants

  • Genetically encoded tension sensors:

    • FRET-based sensors incorporated into MscL to report conformational changes

    • Real-time monitoring of channel activation in living cells

    • Correlation of activation with specific cellular processes

  • Super-resolution microscopy:

    • Visualization of MscL clustering and distribution in bacterial membranes

    • Nanoscale imaging of channel dynamics during osmotic challenges

    • Colocalization studies with other membrane components

  • Bacterial cytological profiling:

    • High-content imaging to correlate MscL expression with morphological changes

    • Particularly valuable for studying transitions between acute and persistent states

    • Can be combined with fluorescent reporters for multiplexed readouts

  • CRISPR interference (CRISPRi):

    • Precise temporal control of mscL expression

    • Titration of expression levels to determine dosage effects

    • Combined with single-cell analysis to capture heterogeneous responses

These methodologies offer unprecedented insight into MscL function within the complex cellular environment, potentially revealing how this channel contributes to Salmonella agona's ability to transition between acute and persistent infection states.

What potential therapeutic applications could emerge from detailed characterization of Salmonella agona MscL?

Understanding the structure and function of Salmonella agona MscL could lead to several therapeutic applications:

  • Antimicrobial development:

    • MscL represents a highly conserved bacterial target absent in mammals

    • Compounds forcing inappropriate channel opening could cause bacterial lysis

    • Small molecules preventing channel closure during osmotic shock would be bactericidal

    • Particularly valuable for treating persistent infections resistant to conventional antibiotics

  • Anti-biofilm strategies:

    • If MscL function is confirmed to influence biofilm formation

    • Modulating MscL activity could potentially disrupt existing biofilms

    • Particularly relevant given the altered biofilm capacity observed in persistent S. agona isolates

  • Diagnostic applications:

    • Detection of MscL expression patterns as biomarkers for transition to persistence

    • Could help identify patients at risk of developing persistent salmonellosis

    • Potential for development of point-of-care tests based on MscL-specific antibodies

  • Vaccine development:

    • Epitopes from extracellular loops of MscL could serve as vaccine components

    • Particularly if antibody binding affects channel function

    • Combined with other membrane antigens for multi-target protection

These applications represent the translational potential of basic research into Salmonella agona MscL, potentially addressing the significant public health challenge posed by persistent Salmonella infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.