Recombinant Salmonella agona Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; SeAg_B0052; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
lspA
Target Protein Sequence
MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPSLNLHYARNYGAAFSF LADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of lspA in Salmonella pathogenicity?

Lipoprotein signal peptidase (lspA) plays a critical role in Salmonella pathogenicity through its essential function in lipoprotein processing. As a type II signal peptidase, lspA removes the signal peptide from prolipoproteins, allowing for proper localization and anchoring of mature lipoproteins to the bacterial cell membrane.

Correctly processed lipoproteins are vital for several pathogenicity-related functions:

  • Maintaining membrane integrity essential for survival within host cells

  • Contributing to adhesion mechanisms required for host cell invasion

  • Participating in nutrient acquisition systems during infection

  • Modulating host immune responses during infection processes

Disruption of lspA function can significantly attenuate Salmonella virulence, as demonstrated in studies of lipid A modification systems that can reduce bacterial virulence by five orders of magnitude in mouse models . Many of the virulence factors identified in Salmonella outbreaks, including the csgA-G curli fiber genes and lpfA-E long polar fimbriae genes, depend on proper lipoprotein processing for their functional assembly and deployment .

How do researchers differentiate between various strains of Salmonella Agona in epidemiological studies?

Differentiation of Salmonella Agona strains in epidemiological studies employs multiple complementary molecular techniques:

  • Phage Typing: Using a panel of 14 bacteriophages, researchers have established a typing scheme that can distinguish 52 distinct phage types among S. Agona strains. This method provides rapid preliminary classification of isolates during outbreak investigations .

  • Pulsed-Field Gel Electrophoresis (PFGE): This technique generates distinctive DNA fragment patterns by cleaving bacterial genomic DNA with restriction enzymes. PFGE has identified 52 different patterns among S. Agona isolates, providing high discriminatory power .

  • Combined Approach: When phage typing and PFGE are used together, they can generate up to 94 distinguishable clonal types among S. Agona strains, significantly enhancing outbreak source attribution .

  • Whole Genome Sequencing (WGS): Modern epidemiological investigations utilize complete genome sequencing followed by SNP calling against reference genomes. This approach allows for phylogenetic analysis that can precisely place outbreak strains within the broader Salmonella population structure .

These methods have successfully traced S. Agona outbreaks to specific sources, such as the contaminated aniseed-containing products identified in Germany through the combined application of phage typing and PFGE .

What methodologies are recommended for expressing and purifying recombinant Salmonella agona lspA for functional studies?

For optimal expression and purification of functional recombinant Salmonella agona lspA, researchers should consider the following methodological approach:

Expression System Design:

  • Vector Selection: Utilize expression vectors with strong, inducible promoters (such as T7 or trc) that permit tight regulation of expression

  • Fusion Tag Strategy: Incorporate N-terminal tags (His6, GST, or MBP) positioned with flexible linkers to facilitate purification while minimizing interference with catalytic activity

  • Signal Sequence Consideration: Either retain the native signal sequence for membrane targeting or replace it with a well-characterized leader sequence like that of β-lactamase for efficient translocation

Expression Conditions:

  • Host Selection: E. coli strains C41(DE3) or C43(DE3) are preferred for membrane protein expression

  • Culture Conditions:

    • Initial growth at 37°C to OD600 of 0.6-0.8

    • Temperature reduction to 18-20°C prior to induction

    • Induction with 0.1-0.5 mM IPTG

    • Extended expression period (16-20 hours) at reduced temperature

Purification Protocol:

  • Membrane Fraction Isolation:

    • Cell disruption via sonication or homogenization in buffer containing 50 mM Tris-HCl, pH 7.5, 150 mM NaCl

    • Differential centrifugation to isolate membrane fractions

  • Solubilization:

    • Treatment with detergents (DDM, LDAO, or C12E8) at concentrations 2-5× their critical micelle concentration

    • Incubation with gentle agitation for 1-2 hours at 4°C

  • Affinity Purification:

    • IMAC purification for His-tagged constructs

    • Gradual detergent reduction during washing steps

    • Elution with imidazole gradient (50-300 mM)

  • Storage:

    • Storage buffer containing 50% glycerol and detergent at concentrations just above CMC

    • Aliquoting and flash-freezing for long-term storage at -80°C

This methodology has been successfully implemented for the production of recombinant membrane-associated enzymes similar to lspA, providing sufficient yields of functionally active protein for both structural and enzymatic characterization.

How can recombinant lspA be incorporated into attenuated Salmonella vaccine delivery systems?

Recombinant lspA can be strategically incorporated into attenuated Salmonella vaccine delivery systems through the following methodological approach:

Vector Construction:

  • Integrate the lspA gene into specialized plasmids designed for stable maintenance in attenuated Salmonella strains

  • Utilize chromosomal integration at defined sites rather than plasmid-based expression to ensure stability in vaccine strains

  • Engineer expression cassettes with arabinose-inducible promoters (PBAD) that allow for regulated expression in vivo

Attenuation Strategy:

  • Begin with established attenuated strains containing defined mutations in genes like ΔpabA1516 and ΔpabB232 that block p-aminobenzoate synthesis

  • Introduce additional mutations such as ΔasdA16 to create auxotrophy for diaminopimelic acid (DAP), ensuring biological containment

  • Incorporate regulated lysis systems by linking lspA expression to essential gene repression (such as asd), creating strains that undergo programmed cell death after antigen delivery

Antigen Fusion Design:

  • Create fusion constructs between lspA and target antigens using the β-lactamase signal sequence (first 35 amino acids) to direct efficient periplasmic localization

  • Position immunogenic epitopes within the fusion construct to maximize accessibility while preserving lspA function

  • Optimize codon usage for efficient expression in Salmonella background

Delivery Validation:

  • Confirm expected subcellular localization using fractionation and immunoblotting techniques

  • Verify appropriate timing of antigen release through regulated lysis mechanisms

  • Measure immune responses through assessment of antibody titers (serum IgG) against both the carrier Salmonella outer membrane proteins and the target antigen

This approach has demonstrated success in vaccine development, with studies showing that fusion proteins directed to the periplasm with approximately 10-20% release into the extracellular environment can generate robust immune responses, including protection against Streptococcus pneumoniae when PspA was used as the model antigen .

What is the relationship between lspA expression and antimicrobial resistance in Salmonella Agona?

The relationship between lspA expression and antimicrobial resistance in Salmonella Agona is complex and multifaceted:

Direct Mechanisms:

  • LspA processes lipoproteins that form part of efflux pump complexes, including components of the RND-family multidrug efflux systems that export antibiotics from bacterial cells

  • Proper functioning of these efflux systems depends on correctly processed lipoproteins anchored in the bacterial membrane

  • Modifications in lspA expression can alter the efficiency of lipoprotein maturation, potentially affecting efflux pump assembly and function

Genetic Context:

  • In multidrug-resistant (MDR) S. Agona isolates, lspA activity must be maintained while antimicrobial resistance genes are acquired

  • Analysis of plasmids from MDR S. Agona reveals that resistance genes cluster in distinct regions of large plasmids (like the 295,499 bp IncHI2 plasmid), separate from areas affecting essential lipoprotein processing

  • These plasmids can carry up to 16 antimicrobial resistance genes organized in two distinct clusters, each associated with composite transposons

Comparative Genomics Evidence:
Genomic analysis of multidrug-resistant S. Agona isolates demonstrates that:

  • The lspA gene remains highly conserved across strains

  • Resistance determinants are typically acquired through horizontal gene transfer via large plasmids

  • These plasmids can confer resistance to 12 different antibiotic classes while preserving normal lspA function

Implications for Resistance Monitoring:

  • Surveillance of proper lspA function alongside antibiotic resistance profiling provides insight into bacterial fitness

  • Identification of lspA variants may help predict the stability of multidrug resistance plasmids in bacterial populations

  • Monitoring plasmid transmission across bacterial genera indicates that plasmids carrying multiple resistance genes found in S. Agona can also be identified in diverse bacterial populations

Research indicates that while lspA itself is not directly responsible for antimicrobial resistance, its essential role in bacterial physiology makes it a constant background feature in the evolution of multidrug-resistant Salmonella strains.

How can researchers effectively design experiments to study lspA function in Salmonella pathogenesis?

Designing effective experiments to study lspA function in Salmonella pathogenesis requires a multifaceted approach:

Genetic Manipulation Strategies:

  • Gene Deletion/Complementation:

    • Create precise chromosomal deletions of lspA using lambda Red recombination system

    • Develop complementation plasmids with inducible promoters to restore lspA function

    • Include epitope tags that allow monitoring of protein expression without disrupting function

  • Site-Directed Mutagenesis:

    • Target conserved catalytic residues based on sequence alignments with characterized homologs

    • Generate point mutations that affect activity without disrupting protein folding

    • Create a library of mutants with varying degrees of enzymatic activity

Functional Assays:

  • Lipoprotein Processing Analysis:

    • Develop reporter constructs fusing fluorescent proteins to known lipoprotein substrates

    • Employ pulse-chase experiments with radioactive labeling to track lipoprotein maturation

    • Utilize mass spectrometry to analyze signal peptide cleavage sites and efficiency

  • Virulence Assessment:

    • Cell invasion assays using epithelial and macrophage cell lines

    • Galleria mellonella infection model for preliminary virulence screening

    • Mouse infection models comparing wild-type and lspA-modified strains

Systems Biology Approaches:

  • Transcriptomics:

    • RNA-seq analysis comparing wild-type and lspA mutants under infection-relevant conditions

    • Identification of differentially expressed virulence-associated genes

  • Proteomics:

    • Membrane proteome analysis focusing on lipoproteins

    • Quantitative comparison of protein abundance between wild-type and mutant strains

    • Assessment of improperly processed lipoproteins in lspA mutants

Control Considerations:

  • Include appropriate vehicle controls for all treatments

  • Utilize multiple bacterial strains to ensure observations are not strain-specific

  • Include positive controls (known lipoprotein processing inhibitors) and negative controls

  • Validate phenotypes through complementation experiments

This methodology has been successfully applied in studies examining lipid A modifications in Salmonella, which demonstrated that alterations in membrane components can dramatically reduce virulence (by five orders of magnitude) while maintaining immunogenicity suitable for vaccine development .

What molecular techniques are most effective for detecting and quantifying lspA expression in clinical Salmonella isolates?

The detection and quantification of lspA expression in clinical Salmonella isolates requires a combination of molecular techniques optimized for sensitivity, specificity, and reproducibility:

Nucleic Acid-Based Methods:

  • Quantitative Real-Time PCR (qRT-PCR):

    • Design primers targeting conserved regions of lspA gene

    • Include reference genes (rpoD, gyrB) for normalization

    • Calculate relative expression using the 2^-ΔΔCt method

  • Digital Droplet PCR (ddPCR):

    • Superior for absolute quantification without standard curves

    • Particularly valuable for low-abundance transcripts

    • Less susceptible to PCR inhibitors often present in clinical samples

Protein Detection Methods:

  • Western Blotting Protocol:

    • Sample Preparation: Bacterial membrane fraction isolation using differential centrifugation

    • Protein Separation: 12-15% SDS-PAGE gels run at 100V

    • Transfer Conditions: 100V for 1 hour using PVDF membranes

    • Detection: Primary antibodies against lspA (1:1000 dilution), followed by HRP-conjugated secondary antibodies (1:5000)

    • Visualization: Enhanced chemiluminescence with digital imaging

    • Quantification: Densitometric analysis normalized to membrane protein controls

  • Mass Spectrometry-Based Approaches:

    • Selected Reaction Monitoring (SRM) for targeted quantification

    • Parallel Reaction Monitoring (PRM) for improved specificity

    • Sample processing through in-gel digestion of membrane fractions

    • Identification of unique peptide sequences for unambiguous lspA detection

Localization and Functional Studies:

  • Immunofluorescence Microscopy:

    • Fixation: 4% paraformaldehyde for 20 minutes

    • Permeabilization: 0.1% Triton X-100 for 10 minutes

    • Antibody staining: Anti-lspA primary (1:200) and fluorophore-conjugated secondary (1:500)

    • Counterstaining: DAPI for nucleic acids

  • Enzymatic Activity Assays:

    • Fluorogenic substrate-based assays measuring peptidase activity

    • Comparison to standard curves generated with purified recombinant lspA

    • Inhibition studies to confirm specificity of measured activity

These methodologies have been successfully employed in studies investigating various Salmonella virulence factors, including analysis of expression patterns during infection and comparison between outbreak and non-outbreak strains .

What bioinformatic approaches should be used to analyze lspA genetic variations across Salmonella strains?

Comprehensive bioinformatic analysis of lspA genetic variations across Salmonella strains requires a systematic approach combining multiple computational methods:

Sequence Acquisition and Quality Control:

  • Database Mining:

    • Extract lspA sequences and flanking regions from public repositories (NCBI, PATRIC)

    • Include metadata on strain origin, isolation source, and phenotypic characteristics

    • Filter sequences based on quality metrics (coverage >30x, Q-score >30)

  • De Novo Assembly for New Isolates:

    • Utilize SPAdes or Unicycler for high-quality genome assembly

    • Perform quality assessment using QUAST

    • Annotate genomes using Prokka with manual verification of lspA loci

Sequence Analysis Pipeline:

  • Multiple Sequence Alignment:

    • Align lspA coding sequences using MUSCLE or MAFFT algorithms

    • Parameters: Gap opening penalty of -2.0, gap extension of -0.1

    • Verify alignments manually at conserved catalytic sites

  • SNP Identification and Characterization:

    • Use Bowtie for read mapping to reference genomes

    • Apply SamTools (v1.3) for SNP calling with minimum quality score thresholds

    • Filter SNPs in phage regions and repetitive sequences

    • Calculate nucleotide diversity (π) and polymorphism statistics

  • Phylogenetic Analysis:

    • Concatenate chromosomal SNP alleles to generate multiple alignments

    • Apply maximum likelihood methods using RAxML (v8.2.4)

    • Parameters: GTRGAMMA substitution model, rapid bootstrap analysis with 1000 replicates

    • Visualize trees using iTOL or FigTree

Functional Impact Assessment:

  • Protein Structure Prediction:

    • Generate 3D models using AlphaFold2 or I-TASSER

    • Assess impact of amino acid substitutions on protein structure

    • Calculate stability changes using FoldX

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios to identify sites under selection

    • Apply FUBAR or MEME algorithms from the HyPhy package

    • Test for recombination using ClonalFrameML

Comparative Genomics:

  • Genomic Context Analysis:

    • Examine synteny of regions flanking lspA across strains

    • Identify potential mobile genetic elements near lspA

    • Compare with virulence gene distribution patterns across strains

  • Pan-genome Analysis:

    • Use Roary or PGAP to construct Salmonella pan-genome

    • Position lspA within core or accessory genome components

    • Correlate lspA variants with antimicrobial resistance patterns

This comprehensive bioinformatic approach has been successfully applied in studies examining Salmonella outbreak strains, revealing important evolutionary relationships and potential functional impacts of genetic variations .

How is lspA being utilized in the development of next-generation Salmonella-based vaccine vectors?

Lipoprotein signal peptidase (lspA) is playing several key roles in the development of next-generation Salmonella-based vaccine vectors through innovative applications:

Regulated Release Systems:

  • Researchers have developed programmed bacterial lysis systems that incorporate the biological activities of lspA to create vaccines that:

    • Allow for precise timing of antigen release within host tissues

    • Enhance immune presentation of vaccine antigens

    • Provide biological containment of recombinant vaccine strains

  • These systems exploit the relationship between lipoprotein processing and membrane integrity, with modifications that:

    • Couple antigen expression with programmed cell death mechanisms

    • Prevent bacterial persistence while maximizing immunogenicity

    • Eliminate the need for antibiotic resistance markers in vaccine constructs

Antigen Presentation Enhancement:

  • Strategic fusion constructs combining:

    • β-lactamase signal sequences directing proteins to the periplasm

    • lspA-dependent processing mechanisms for controlled release

    • Immunogenic epitopes from target pathogens (like pneumococcal surface protein A)

  • These fusion systems have demonstrated:

    • Significant improvement in antigen-specific immune responses

    • Protection against both Salmonella and heterologous pathogens

    • Balanced humoral and cell-mediated immune responses

Chromosomal Integration Approaches:

  • Modern vaccine designs now favor:

    • Chromosome-integrated expression systems over plasmid-based ones

    • Identification of optimal chromosomal locations for lspA and antigen gene insertion

    • Systems that maintain stable expression without selective pressure

  • This approach addresses previous limitations by:

    • Eliminating plasmid instability issues in vaccine strains

    • Allowing for multiple antigen expressions from different chromosomal locations

    • Improving the regulatory approval pathway for clinical applications

Future Directions:
Current research is focused on:

  • Creating universal Salmonella vector platforms with standardized lspA-based antigen processing systems

  • Developing targeted delivery systems for mucosal immunity enhancement

  • Exploring combination approaches with adjuvant molecules co-expressed in the same vector system

These advances represent significant progress beyond earlier generation vectors, with recent studies demonstrating protection against challenge with virulent Streptococcus pneumoniae following oral immunization with Salmonella expressing PspA through these advanced delivery systems .

What are the latest findings regarding the role of lspA in antibiotic resistance mechanisms in clinical Salmonella isolates?

Recent investigations have revealed complex interactions between lspA functionality and antibiotic resistance mechanisms in clinical Salmonella isolates:

Plasmid-Mediated Resistance Associations:

  • Whole genome sequencing of multidrug-resistant (MDR) S. Agona isolates has revealed large plasmids (up to 295,499 bp) that carry:

    • 16 distinct antimicrobial resistance genes organized in two clusters

    • Resistance determinants to 12 different antibiotic classes

    • Mobile genetic elements facilitating horizontal transfer

  • These plasmids maintain normal lspA function while conferring resistance through:

    • Composite transposons housing resistance gene clusters

    • Preservation of essential lipoprotein processing pathways

    • Stable integration into diverse Salmonella genetic backgrounds

Membrane Integrity and Permeability:

  • Recent studies demonstrate that lspA-dependent lipoprotein processing affects:

    • Outer membrane permeability to hydrophobic antibiotics

    • Assembly of RND-family efflux pump complexes

    • Resistance to antimicrobial peptides produced by the host immune system

  • Clinical isolates exhibit evolutionary pressure to maintain proper lspA function while:

    • Acquiring genes conferring resistance to multiple antibiotics

    • Preserving fitness and virulence capabilities

    • Adapting to selective pressures in various host environments

Cross-Species Plasmid Transfer:

  • Comparative genomic analyses have shown that:

    • Plasmids containing multiple resistance genes can be found in S. Agona and other bacterial genera

    • These plasmids have complex evolutionary histories spanning diverse isolation sources

    • Horizontal gene transfer facilitates the spread of resistance determinants while preserving essential functions like lspA

  • This phenomenon explains:

    • The rapid emergence of multidrug resistance in previously susceptible strains

    • The consistent co-occurrence of specific resistance patterns across species barriers

    • The preservation of essential physiological functions during acquisition of resistance traits

Surveillance Implications:

  • Studies now recommend:

    • Monitoring both lspA sequence variation and antimicrobial resistance profiles

    • Assessing the stability of resistance determinants in clinical isolates

    • Tracking plasmid transmission across bacterial species boundaries

  • This approach has identified:

    • Emerging resistance patterns in novel food items not yet heavily regulated

    • Potential reservoirs of resistance genes in environmental and agricultural settings

    • High-risk plasmid types that readily disseminate through bacterial populations

These findings highlight the complex interplay between essential physiological processes mediated by lspA and the acquisition and maintenance of antimicrobial resistance determinants in clinically relevant Salmonella isolates.

What contradictions exist in the current understanding of lspA function, and how might these be resolved through future research?

Several significant contradictions persist in our understanding of lspA function in Salmonella, presenting opportunities for resolution through targeted research approaches:

Contradictory Findings in Virulence Studies:

  • The Attenuation Paradox:

    • Some studies indicate lspA disruption severely attenuates Salmonella virulence

    • Contradictory reports suggest certain lspA mutations can enhance virulence in specific host contexts

    • This discrepancy likely stems from differential effects on specific lipoprotein subsets

    Resolution Strategy:

    • Conduct systematic mutagenesis of lspA, creating a gradient of functional alterations

    • Evaluate each variant across multiple infection models (cell culture, invertebrate, and vertebrate)

    • Apply proteomics to identify differentially processed lipoproteins in each variant

  • Immunogenicity vs. Pathogenicity Tension:

    • Studies show lspA-modified strains with reduced virulence maintain immunogenicity

    • Contradictory evidence suggests immunogenic capacity should correlate with active infection processes

    • The mechanisms separating these properties remain incompletely defined

    Resolution Strategy:

    • Develop dual-reporter systems tracking both bacterial replication and antigen presentation

    • Create chimeric lspA variants that differentially process immunogenic vs. virulence-associated lipoproteins

    • Employ systems biology approaches to map the relationship network between processed lipoproteins

Methodological Contradictions:

  • Expression System Disparities:

    • Plasmid-based expression systems show different functional outcomes compared to chromosomal integration

    • Different researchers report varying stability of lspA expression constructs

    • The optimal expression parameters remain contested

    Resolution Strategy:

    • Conduct direct comparative studies using standardized strains and conditions

    • Implement cutting-edge genome editing techniques for precise modifications

    • Develop quantitative assays for lspA activity that can be universally applied

  • Discrepancies in Resistance Associations:

    • Some studies show strong correlations between specific lspA variants and resistance profiles

    • Other research fails to identify consistent associations between lspA sequence and resistance phenotypes

    • The causal relationship between lspA function and resistance mechanisms remains unclear

    Resolution Strategy:

    • Perform comprehensive genome-wide association studies with larger strain collections

    • Implement experimental evolution approaches under controlled selective pressures

    • Develop better computational models integrating protein function, genetic context, and resistance phenotypes

Theoretical Framework Conflicts:

  • Evolutionary Conservation vs. Functional Plasticity:

    • The lspA sequence is highly conserved across Salmonella serovars

    • Yet functional studies suggest considerable adaptability in substrate recognition

    • This apparent contradiction challenges current theoretical models of enzyme evolution

    Resolution Strategy:

    • Apply ancestral sequence reconstruction to trace evolutionary trajectories

    • Conduct deep mutational scanning to map sequence-function relationships

    • Develop structural biology approaches to visualize lspA-substrate interactions

  • Host-Pathogen Interface Ambiguities:

    • Current models poorly explain how lspA-processed lipoproteins interact with host innate immunity

    • Contradictory findings exist regarding recognition of these lipoproteins by host pattern recognition receptors

    • The role of lspA in modulating host responses remains incompletely defined

    Resolution Strategy:

    • Develop co-culture systems with defined genetic backgrounds in both pathogen and host

    • Apply single-cell approaches to resolve population heterogeneity effects

    • Implement host-pathogen protein-protein interaction mapping technologies

Resolving these contradictions will require interdisciplinary approaches combining structural biology, systems-level analysis, and precise genetic manipulation technologies that have only recently become available to Salmonella researchers.

What are the most promising therapeutic applications targeting lspA in Salmonella infections?

The most promising therapeutic applications targeting lspA in Salmonella infections span several innovative approaches:

Inhibitor Development:

  • Structure-Based Drug Design:

    • Rational development of small molecule inhibitors targeting the lspA active site

    • Design parameters focusing on membrane penetration and target specificity

    • Computational screening of chemical libraries against structural models

  • Peptide-Based Inhibitors:

    • Development of substrate-mimetic peptides that competitively inhibit lspA

    • Incorporation of non-cleavable peptide bonds at the recognition site

    • Conjugation with cell-penetrating peptides for enhanced delivery

Vaccine Approaches:

  • Attenuated Live Vaccines:

    • Engineering of Salmonella strains with regulated lspA expression

    • Development of programmed lysis systems for controlled antigen release

    • Demonstration of protection against multiple pathogens through heterologous antigen delivery

  • Subunit Vaccine Components:

    • Identification of immunodominant epitopes from lspA-processed lipoproteins

    • Rational design of subunit vaccines targeting conserved lipoprotein structures

    • Development of adjuvant formulations enhancing immune responses to these components

Targeted Delivery Systems:

  • Bacteriophage-Based Approaches:

    • Engineering phages to deliver lspA inhibitors specifically to Salmonella

    • Development of phage cocktails targeting multiple virulence mechanisms

    • Integration with conventional antimicrobial therapies

  • Nanoparticle Delivery Platforms:

    • Development of lipid nanoparticles encapsulating lspA inhibitors

    • Surface modification with Salmonella-targeting ligands

    • Co-delivery of conventional antibiotics for synergistic effects

Diagnostic Applications:

  • Rapid Detection Systems:

    • Development of aptamer-based sensors detecting lspA activity

    • Point-of-care diagnostics identifying specific Salmonella serovars

    • Integration with antimicrobial susceptibility testing

The regulated programmed lysis system incorporating lspA-dependent mechanisms has shown particular promise, with documented protective efficacy against both Salmonella and heterologous pathogens in animal models . The ability to deliver antigens while ensuring biological containment addresses key safety concerns in vaccine development and opens avenues for therapeutic applications beyond prevention.

How does our current understanding of lspA contribute to broader concepts in bacterial pathogenesis and host-pathogen interactions?

Our current understanding of lspA contributes significantly to broader concepts in bacterial pathogenesis and host-pathogen interactions across multiple dimensions:

Evolutionary Perspectives:

  • Conservation vs. Specialization:

    • The high conservation of lspA across bacterial species indicates its fundamental role in bacterial physiology

    • Subtle variations in substrate specificity reflect evolutionary adaptations to different ecological niches

    • This balance between conservation and specialization exemplifies broader principles of pathogen evolution

  • Horizontal Gene Transfer Dynamics:

    • Studies of large plasmids carrying antimicrobial resistance genes while preserving essential functions like lspA processing demonstrate how bacteria balance acquisition of new traits with maintenance of core functions

    • This illustrates fundamental principles governing the spread of resistance and virulence determinants

Systems Biology Concepts:

  • Regulatory Networks:

    • The integration of lspA function within broader lipoprotein processing pathways exemplifies how bacteria coordinate membrane biogenesis with environmental adaptation

    • This represents a model system for understanding bacterial regulatory networks responding to host environments

  • Fitness Tradeoffs:

    • The relationship between lspA function, membrane integrity, and antimicrobial resistance demonstrates how pathogens navigate fitness landscapes

    • This provides insight into fundamental evolutionary constraints facing bacterial pathogens

Host-Pathogen Interface:

  • Pattern Recognition and Immune Modulation:

    • LspA-processed lipoproteins interact with host pattern recognition receptors, including TLR2

    • The modification of lipoproteins represents a strategy for immune modulation that extends beyond Salmonella to numerous bacterial pathogens

  • Membrane Architecture and Host Interactions:

    • The role of correctly processed lipoproteins in shaping bacterial surface architecture influences:

      • Adhesion to host tissues

      • Resistance to host antimicrobial peptides

      • Recognition by the host immune system

Therapeutic Design Principles:

  • Vulnerability Identification:

    • The essential nature of lspA in bacterial physiology exemplifies how identifying vulnerabilities requires understanding of both bacterial requirements and therapeutic accessibility

    • This contributes to broader principles for antimicrobial target selection

  • Multifunctional Intervention Design:

    • The dual use of lspA-based systems for both attenuation and antigen delivery in vaccine development illustrates the value of multifunctional approaches in therapeutic design

    • This concept extends to numerous areas of antimicrobial development

The study of lspA thus provides a microcosm for understanding fundamental principles of bacterial adaptation, host interaction, and therapeutic intervention that extend far beyond Salmonella to inform our broader understanding of infectious disease processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.