Recombinant Salmonella agona Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella agona Monofunctional Biosynthetic Peptidoglycan Transglycosylase (mtgA)

Recombinant Salmonella agona Monofunctional Biosynthetic Peptidoglycan Transglycosylase (mtgA) is a protein expressed in Escherichia coli and derived from Salmonella agona. This enzyme plays a crucial role in the biosynthesis of peptidoglycan, a key component of bacterial cell walls. Peptidoglycan, also known as murein, is essential for maintaining the structural integrity and shape of bacteria, as well as protecting them from osmotic stress.

Function and Significance of mtgA

The mtgA protein functions as a monofunctional biosynthetic peptidoglycan transglycosylase. This means it is involved in the polymerization of glycan chains during peptidoglycan synthesis but does not possess transpeptidase activity, which is typically responsible for cross-linking the peptide chains. The enzyme is crucial for the formation of the peptidoglycan layer, which is vital for bacterial survival and resistance to environmental stresses.

References

  • Creative Biomart. Recombinant Full Length Salmonella Agona Monofunctional Biosynthetic Peptidoglycan Transglycosylase(Mtga) Protein, His-Tagged. [Accessed 2025].

  • PubMed. Monofunctional biosynthetic peptidoglycan transglycosylases. [Accessed 1996].

  • eLife. A lytic transglycosylase connects bacterial focal adhesion... [Accessed 2024].

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; SeAg_B3516; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-242
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
mtgA
Target Protein Sequence
MSKRRIAPLTFLRRLLLRILAALAVFWGGGIALFSVVPVPFSAVMAERQISAWLGGEFGY VAHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLS QQTAKNLFLWDGRSWLRKGLEAGLTLGIETVWSKKRILTVYLNIAEFGDGIFGVEAAAQR YFHKPASRLNMSEAALLAAVLPNPLRYKANAPSGYVRSRQAWIMRQMRQLGGESFMTRNQ LN
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.