Recombinant Salmonella agona NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Identification

  • Name: NADH-quinone oxidoreductase subunit A

  • Gene Name: nuoA

  • Synonyms: NADH dehydrogenase I subunit A, NDH-1 subunit A

  • Enzyme Class: Oxidoreductase

  • Species: Salmonella enterica serovar Agona

Biological Properties

  • General Function: Involved in oxidoreductase activity, acting on NADH or NADPH .

  • Specific Function: NDH-1 transfers electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain . It is believed that the immediate electron acceptor for the enzyme is ubiquinone, which links the redox reaction to proton translocation. For every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane, thus preserving the redox energy in a proton gradient .

  • Cellular Location: Cell inner membrane; Multi-pass membrane protein

Structure and Composition

NADH-quinone oxidoreductase I (NDH-1) is a multi-subunit enzyme complex . In Escherichia coli, it consists of the following subunits: NuoA, NuoH, NuoJ, NuoK, NuoL, NuoM, NuoN, NuoB, NuoC, NuoE, NuoF, NuoG, and NuoI . NuoA is a membrane subunit of NDH-1 . The Salmonella dublin NuoA protein consists of 147 amino acids .

AA Sequence of Salmonella dublin NuoA protein: MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARI GALDWTPARSRRERMNPETNSIANRQR

Function and Mechanism

NDH-1 catalyzes the transfer of electrons from NADH to quinones, utilizing FMN and iron-sulfur clusters as redox centers . This process is coupled to the translocation of protons across the cytoplasmic membrane, generating a proton gradient that can be used to drive ATP synthesis .

Role in Salmonella Physiology

The primary mobile electron-carrier in the aerobic respiratory chain of Salmonella is ubiquinone . NDH-1 is required for the anaerobic respiration of NADH using fumarate or DMSO as the terminal electron acceptors, thus implying that the enzyme can transfer electrons to menaquinone . Mutants with missense mutations in nuoG, nuoM, and nuoN can rescue motility of a Salmonella ubiquinone-biosynthesis mutant strain . Under certain growth conditions, the suppressor mutations improved electron flow activity of NADH: quinone oxidoreductase-1 for cells bearing a ubiA deletion mutation .

Applications in Research

Recombinant forms of NuoA are used in biochemical research to study the structure, function, and regulation of NADH-quinone oxidoreductases . For example, the single-subunit NADH dehydrogenase of Saccharomyces cerevisiae (Ndi1P) can work as a replacement for complex I in mammalian cells . The cells expressing the Ndi1 protein were resistant to known inhibitors of complex I, such as rotenone and pyridaben . It is conceivable that the NDI1 gene will be a promising tool in the treatment of neurodegenerative conditions caused by complex I inhibition .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; SeAg_B2467; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase and what role does the nuoA subunit play?

NADH-quinone oxidoreductase is a critical enzyme complex in the bacterial respiratory chain, serving as the primary entry point for electrons into the respiratory chain. It catalyzes the transfer of electrons from NADH to quinones such as ubiquinone, demethylmenaquinone, or menaquinone . The complex consists of multiple subunits organized into two main domains: a hydrophilic domain (containing subunits like NuoG) and a hydrophobic membrane-embedded domain (containing subunits like NuoM and NuoN) .

The nuoA subunit is part of the membrane domain of the complex and contributes to the structural integrity and functional activity of the NADH-quinone oxidoreductase enzyme. It plays a role in anchoring the complex to the membrane and facilitating electron transfer between the hydrophilic and hydrophobic domains. Although the search results don't provide specific details about nuoA in Salmonella agona, studies on similar subunits reveal their importance in maintaining proper enzyme function and bacterial respiration .

How does NADH-quinone oxidoreductase function in Salmonella respiration?

In Salmonella, NADH-quinone oxidoreductase functions as a fundamental component of both aerobic and anaerobic respiratory chains. Under aerobic conditions, it transfers electrons from NADH primarily to ubiquinone, which serves as the main mobile electron carrier . The electrons then flow through the respiratory chain to terminal electron acceptors like oxygen, generating a proton motive force for ATP synthesis.

Under anaerobic conditions, alternative electron carriers such as demethylmenaquinone and menaquinone become important . The NADH-quinone oxidoreductase can adapt to using these alternative quinones, though often with reduced efficiency. This adaptation is crucial for Salmonella's ability to survive in different environments, including the anaerobic conditions of the intestinal tract.

Research has shown that mutations in ubiquinone biosynthesis genes (ubiA or ubiE) lead to poor motility and growth in Salmonella, but suppressor mutations in NADH-quinone oxidoreductase subunits can partially rescue these phenotypes by improving electron flow to alternative quinones . This demonstrates the adaptability of the respiratory system and the importance of NADH-quinone oxidoreductase in bacterial energy metabolism.

What genetic elements are associated with nuoA in Salmonella agona?

While the search results don't provide specific information about genetic elements directly associated with nuoA in Salmonella agona, we can infer from studies on related Salmonella strains. The nuoA gene is part of the nuo operon, which typically contains 13-14 genes encoding the various subunits of NADH-quinone oxidoreductase. This operon is chromosomally encoded and highly conserved among various Salmonella serovars.

Salmonella agona has been shown to harbor various mobile genetic elements, including genomic islands and plasmids that carry antibiotic resistance genes . For instance, Salmonella genomic island 1 (SGI1) has been identified in Salmonella agona strains, containing multiple resistance genes . Additionally, large plasmids like the 295,499 bp IncHI2 family plasmid found in a multidrug-resistant S. agona isolate can carry numerous antibiotic resistance genes and heavy metal resistance determinants .

How do mutations in nuoA affect Salmonella metabolism and virulence?

Mutations in NADH-quinone oxidoreductase subunits can significantly impact Salmonella metabolism and potentially its virulence. Research on mutations in other nuo subunits provides insight into the possible effects of nuoA mutations. For example, suppressor mutations in nuoG (Q297K), nuoM (A254S), and nuoN (A444E) have been shown to improve electron flow activity when ubiquinone biosynthesis is disrupted . These mutations allow the enzyme to better utilize alternative electron carriers like demethylmenaquinone and menaquinone.

The effects of such mutations include:

  • Altered respiration efficiency: Mutations may enhance or impair electron transfer rates, affecting ATP production.

  • Changed growth characteristics: As observed with suppressor mutations, certain changes can rescue growth defects in quinone biosynthesis mutants .

  • Modified motility: NADH-quinone oxidoreductase function is linked to bacterial motility, with suppressor mutations partially rescuing swimming ability in soft agar .

  • Potential impacts on virulence: Since energy metabolism is critical for infection processes, alterations in respiratory chain function could affect Salmonella's ability to colonize hosts and cause disease.

Understanding nuoA mutations specifically would require directed mutagenesis studies followed by phenotypic characterization, including growth curve analysis, respiration measurements, and possibly infection models to assess virulence impacts.

What techniques are most effective for characterizing the structure-function relationship of recombinant nuoA?

Characterizing the structure-function relationship of recombinant nuoA requires a multi-faceted approach combining structural biology, biochemistry, and molecular genetics techniques:

  • Protein Expression and Purification: Heterologous expression systems (e.g., E. coli) can be used to produce recombinant nuoA tagged with affinity purification markers (His-tag, GST, etc.) for subsequent purification .

  • Structural Analysis:

    • X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure

    • NMR spectroscopy for dynamics studies

    • Computational modeling based on homologous structures

  • Functional Assays:

    • Electron transfer activity measurements using spectrophotometric methods to monitor NADH oxidation

    • Membrane incorporation studies to assess proper folding and insertion

    • Reconstitution of the complex with other nuo subunits to evaluate assembly

  • Site-Directed Mutagenesis:

    • Systematic mutation of conserved residues to assess their importance

    • Creation of chimeric proteins with homologous subunits from other species

    • In vivo complementation studies in nuoA deletion mutants

  • Interaction Analysis:

    • Cross-linking studies to identify interacting partners

    • Co-immunoprecipitation to confirm protein-protein interactions

    • Blue native PAGE to study complex assembly

Each technique provides complementary information, and their combination allows for a comprehensive understanding of how nuoA's structure relates to its function within the NADH-quinone oxidoreductase complex.

How does the quinone pool composition affect NADH-quinone oxidoreductase activity in Salmonella agona?

Strains with ubiA deletion mutations produce demethylmenaquinone and menaquinone, while ubiE deletion mutants produce demethylmenaquinone and 2-octaprenyl-6-methoxy-1,4-benzoquinone . These alterations in the quinone pool are associated with a reduction in the total quinone content and impaired respiratory function.

The relationship between quinone pool composition and NADH-quinone oxidoreductase activity can be summarized in the following table:

Immunoblotting analyses have shown increased NADH-quinone oxidoreductase-1 levels in ubiquinone-biosynthesis mutant strains, suggesting a compensatory response to the altered quinone pool . Enzyme assays have confirmed that electron transfer from NADH to demethylmenaquinone or menaquinone can occur, albeit less efficiently than to ubiquinone under normal conditions .

What genomic approaches can be used to study nuoA conservation across Salmonella serovars?

Several genomic approaches can be employed to study nuoA conservation across Salmonella serovars:

  • Whole Genome Sequencing (WGS): Complete genome sequencing of multiple Salmonella serovars provides the foundation for comparative genomic analyses . Using technologies like Illumina short-read sequencing combined with long-read technologies (Pacific Biosciences or Oxford Nanopore) enables the assembly of complete genomes, including the nuoA region .

  • Comparative Genomic Analysis:

    • Multiple sequence alignment of nuoA sequences from different serovars

    • Phylogenetic analysis to understand evolutionary relationships

    • Identification of conserved domains and variable regions

    • Calculation of nucleotide diversity (π) and other population genetic statistics

  • Single Nucleotide Polymorphism (SNP) Analysis: Methods like the CFSAN SNP Pipeline can identify variable sites between genomes, allowing for fine-scale differentiation between closely related strains . Applying SNP density filters helps remove variants resulting from recombination or mobile elements .

  • Structural Variation Detection: Tools like MAUVE aligner or BRIG (BLAST Ring Image Generator) can visualize genomic differences between strains, identifying insertions, deletions, or rearrangements in the nuo operon region .

  • Pan-genome Analysis: Characterizing core genes (present in all strains) versus accessory genes helps determine if nuoA is part of the core Salmonella genome and identify any strain-specific variations.

These approaches have been successfully applied to track Salmonella outbreaks and evolution over time, as demonstrated by studies on S. Agona outbreaks in 1998 and 2008 . Similar methodologies could be applied specifically to study nuoA conservation and variation across Salmonella serovars.

What are the optimal conditions for expressing recombinant Salmonella agona nuoA?

Optimal expression of recombinant Salmonella agona nuoA requires careful consideration of expression systems, vectors, and conditions. While the search results don't provide specific protocols for nuoA expression, general principles for membrane protein expression can be applied:

Expression System Selection:

  • E. coli: The BL21(DE3) strain or its derivatives are commonly used for recombinant protein expression. For membrane proteins like nuoA, C41(DE3) or C43(DE3) strains, which are better at accommodating membrane protein overexpression, may be preferable.

  • Cell-free expression systems: These can be advantageous for membrane proteins as they eliminate toxicity issues associated with membrane protein overexpression in living cells.

Vector and Construct Design:

  • Use vectors with tunable promoters (e.g., T7 lac or arabinose-inducible promoters)

  • Include fusion tags (His6, GST, MBP) to facilitate purification

  • Consider codon optimization for the expression host

  • Include fusion partners that enhance solubility or assist in membrane insertion

Expression Conditions:

  • Temperature: Lower temperatures (16-25°C) often improve proper folding

  • Induction timing: Induce at mid-log phase (OD600 ≈ 0.6-0.8)

  • Inducer concentration: Use lower concentrations of IPTG (0.1-0.5 mM) or arabinose (0.002-0.02%)

  • Duration: Extended expression periods (overnight at lower temperatures)

  • Media: Enriched media (2xYT, TB) or defined media for specific applications

Membrane Fraction Isolation:

  • Cell disruption by sonication or French press

  • Differential centrifugation to separate membrane fractions

  • Solubilization with appropriate detergents (DDM, LDAO, OG)

The optimization process should involve systematic testing of these variables, with protein yield, purity, and functional activity as evaluation criteria. Western blotting, enzyme activity assays, and structural integrity assessments should be performed to ensure the recombinant protein maintains its native properties.

How can researchers effectively characterize the electron transfer function of nuoA in vitro?

Characterizing the electron transfer function of nuoA in vitro presents challenges due to its integral membrane nature and its function as part of a multi-subunit complex. Effective characterization requires both isolation of the protein and development of appropriate functional assays:

Protein Preparation:

  • Purification of recombinant nuoA or isolation of the entire NADH-quinone oxidoreductase complex

  • Reconstitution into liposomes or nanodiscs to provide a membrane-like environment

  • Verification of proper folding and orientation using circular dichroism spectroscopy or fluorescence-based assays

Electron Transfer Assays:

  • NADH Oxidation Assay: Monitor the decrease in NADH absorption at 340 nm in the presence of various quinone acceptors (ubiquinone, menaquinone, demethylmenaquinone)

  • Quinone Reduction Assay: Track the reduction of quinones using absorption spectroscopy or HPLC-based methods

  • Oxygen Consumption Measurements: Using oxygen electrodes to measure respiratory activity in reconstituted systems

  • Artificial Electron Acceptor Assays: Using compounds like ferricyanide as alternative electron acceptors

Kinetic Characterization:

  • Determination of Km and Vmax values for NADH and various quinone substrates

  • Inhibitor studies using compounds like rotenone or piericidin A

  • pH dependence profiling to identify optimal conditions and key residues

Specific nuoA Function:
Since nuoA is one subunit of the complex, its specific role can be investigated by:

  • Comparing wild-type and mutant forms of nuoA in reconstituted systems

  • Using cross-linking approaches to identify interaction partners

  • Employing site-directed spin labeling and EPR spectroscopy to track electron movement

What protocols are recommended for studying the interaction between nuoA and other subunits of the NADH-quinone oxidoreductase complex?

Studying protein-protein interactions between nuoA and other subunits of the NADH-quinone oxidoreductase complex requires specialized techniques for membrane protein complexes. The following protocols are recommended:

Co-purification Approaches:

  • Tandem affinity purification (TAP): Tag nuoA with a TAP tag and identify co-purifying subunits by mass spectrometry

  • Pull-down assays: Use recombinant nuoA with affinity tags to capture interacting partners

  • Blue native PAGE: Preserve native protein complexes for separation and identification of subunit composition

Cross-linking Methods:

  • Chemical cross-linking: Use bifunctional reagents like DSS, BS3, or formaldehyde to stabilize transient interactions

  • Photo-cross-linking: Incorporate photo-activatable amino acids into nuoA for site-specific cross-linking

  • Cross-linking mass spectrometry (XL-MS): Identify cross-linked peptides to map interaction interfaces

Biophysical Interaction Analysis:

  • Surface plasmon resonance (SPR): Measure real-time binding kinetics between immobilized nuoA and other subunits

  • Isothermal titration calorimetry (ITC): Determine thermodynamic parameters of binding

  • Microscale thermophoresis (MST): Detect interactions based on changes in thermophoretic mobility

Structural Biology Approaches:

  • Cryo-electron microscopy: Visualize the entire complex architecture at near-atomic resolution

  • X-ray crystallography: Determine structures of subcomplexes containing nuoA

  • NMR spectroscopy: Map interaction surfaces using chemical shift perturbations

Genetic and In Vivo Methods:

  • Bacterial two-hybrid assays: Adapted for membrane proteins to detect interactions in vivo

  • Suppressor mutation analysis: Identify compensatory mutations in interacting subunits as seen in studies of other nuo subunits

  • In vivo cross-linking: Perform cross-linking in intact cells to capture physiologically relevant interactions

These methods can be used in combination to build a comprehensive map of nuoA interactions within the NADH-quinone oxidoreductase complex, providing insights into both structural organization and functional coordination among subunits.

How can researchers differentiate between the roles of different NADH-quinone oxidoreductase subunits in Salmonella virulence?

Differentiating the specific contributions of individual NADH-quinone oxidoreductase subunits, including nuoA, to Salmonella virulence requires a systematic approach combining genetic manipulation, functional assays, and infection models:

Genetic Manipulation Approaches:

  • Gene deletion mutants: Create clean deletion mutants of individual nuo subunit genes, including nuoA

  • Complementation studies: Reintroduce wild-type or mutated versions of the deleted genes

  • Domain swapping: Replace domains between subunits to identify functional regions

  • Point mutations: Introduce specific mutations based on structural predictions

In Vitro Virulence-Related Phenotypes:

  • Growth curve analysis: In various media mimicking host environments (low pH, limited nutrients, etc.)

  • Stress resistance assays: Measure survival under oxidative stress, antimicrobial peptides, or acid stress

  • Motility assays: Assess swimming, swarming, and chemotaxis capabilities

  • Biofilm formation: Quantify ability to form biofilms on various surfaces

Cell Culture Infection Models:

  • Invasion assays: Measure ability to invade epithelial cells

  • Intracellular survival: Quantify replication within macrophages

  • Cytokine induction: Measure host cell inflammatory responses

  • Cell death assays: Assess cytotoxicity and cell death mechanisms

Animal Infection Models:

  • Competitive index assays: Compare colonization efficiency of wild-type versus mutant strains

  • Organ burden determination: Measure bacterial loads in different tissues

  • Survival studies: Monitor host survival after infection

  • Immunological profiling: Characterize host immune responses

Transcriptomic and Proteomic Analysis:

  • RNA-Seq: Compare gene expression profiles of different mutants during infection

  • Proteomics: Identify changes in protein levels and post-translational modifications

  • Metabolomics: Assess metabolic adaptations in different mutants

By systematically applying these approaches, researchers can disentangle the specific contributions of nuoA from those of other NADH-quinone oxidoreductase subunits to Salmonella virulence, potentially identifying novel targets for antimicrobial development.

How can understanding nuoA function contribute to developing new antimicrobial strategies?

Understanding nuoA function within the NADH-quinone oxidoreductase complex can contribute significantly to antimicrobial development through several avenues:

Target Validation:

  • NADH-quinone oxidoreductase is essential for bacterial respiration and energy production, making it a potentially vital target

  • The bacterial enzyme differs structurally from the mitochondrial complex I in human cells, offering selectivity

  • Inhibition of this complex could impair bacterial growth and virulence while minimizing host toxicity

Drug Development Strategies:

  • Structure-based drug design: Using structural information about nuoA and its interactions to design small molecule inhibitors that specifically disrupt its function

  • Natural product derivatives: Several natural compounds target bacterial respiratory chains and could serve as scaffolds for developing nuoA-specific inhibitors

  • Peptide inhibitors: Designing peptides that mimic interaction interfaces between nuoA and other subunits to disrupt complex assembly

Targeting Resistance Mechanisms:
Research has shown that mutations in NADH-quinone oxidoreductase subunits can compensate for defects in ubiquinone biosynthesis . Understanding these adaptive mechanisms could help design combination therapies that prevent resistance development. For example, combining inhibitors of both ubiquinone biosynthesis and NADH-quinone oxidoreductase could create a synergistic effect difficult for bacteria to overcome.

Alternative Approaches:

  • Attenuated vaccine development: nuoA mutants with reduced virulence but retained immunogenicity could serve as live attenuated vaccine candidates

  • Pathogen-specific delivery systems: Targeting antimicrobials specifically to bacteria expressing nuoA

  • Anti-virulence approaches: If nuoA affects virulence factor expression, targeting it could reduce pathogenicity without directly killing bacteria, potentially reducing selective pressure for resistance

The relationship between respiratory chain function and antimicrobial resistance observed in multidrug-resistant Salmonella isolates suggests that targeting nuoA could potentially sensitize resistant bacteria to existing antibiotics, offering a strategy to revitalize our current antimicrobial arsenal.

What experimental models are most appropriate for studying nuoA function in Salmonella infection?

Selecting appropriate experimental models for studying nuoA function during Salmonella infection requires consideration of different aspects of pathogenesis. The following models offer complementary advantages:

In Vitro Cellular Models:

  • Epithelial cell lines (e.g., Caco-2, HT-29): Model intestinal invasion, particularly valuable for studying the role of nuoA in initial infection stages

  • Macrophage models (e.g., RAW264.7, THP-1): Assess intracellular survival and replication, crucial for understanding nuoA's role in persistent infection

  • 3D organoid cultures: More physiologically relevant than traditional cell lines, providing tissue-like architecture

  • Co-culture systems: Combining epithelial cells with immune cells to model complex host-pathogen interactions

Ex Vivo Models:

  • Intestinal tissue explants: Maintain the complex tissue architecture of the intestine

  • Perfused organ systems: Allow for studying Salmonella infection in intact organ systems

  • Precision-cut tissue slices: Provide multicellular environments while maintaining tissue architecture

In Vivo Animal Models:

  • Mouse models:

    • Streptomycin-pretreated mice (acute colitis model)

    • Typhoid fever models using susceptible mouse strains

    • Chronic carrier models

  • Alternative animal models:

    • Galleria mellonella (wax moth larvae): Cost-effective screening model

    • Caenorhabditis elegans: Genetic tractability and transparency

    • Zebrafish: Transparent larvae allow real-time visualization of infection

Specialized Systems for Respiratory Chain Studies:

  • Oxygen-controlled culture systems: To study nuoA function under varying oxygen tensions

  • In vivo expression technology (IVET): To monitor nuoA expression during different infection stages

  • Transposon sequencing (TnSeq): To assess the importance of nuoA in different infection niches

Model Selection Considerations:

  • The infection phase being studied (invasion, intracellular survival, dissemination)

  • The specific host environment (oxygen levels, nutrient availability)

  • The research question (gene expression, protein function, host response)

For comprehensive understanding, a combination of models should be employed, starting with simpler systems for mechanistic studies and progressing to more complex models to validate findings in physiologically relevant contexts.

How does the genetic background of different Salmonella agona strains affect nuoA expression and function?

The genetic background of different Salmonella agona strains can significantly influence nuoA expression and function through several mechanisms:

Genomic Variation and Evolution:
Whole genome sequencing studies of Salmonella agona have revealed considerable genomic diversity among strains, even those involved in related outbreaks . For example, analysis of S. agona isolates from the 1998 and 2008 outbreaks showed they were closely related but had accumulated SNP differences over time . Such genetic variations could affect nuoA expression and function through:

  • Regulatory network differences: Mutations in global regulators or nuoA-specific regulators

  • Promoter region variations: Affecting transcription initiation and efficiency

  • Operon structure alterations: Influencing co-transcription with other nuo genes

Acquisition of Mobile Genetic Elements:
Salmonella agona strains frequently harbor various mobile genetic elements that can influence gene expression globally:

  • Genomic islands: Elements like Salmonella Genomic Island 1 (SGI1) have been identified in S. agona and contain genes that could affect gene expression globally

  • Plasmids: Large plasmids like the 295,499 bp plasmid found in multidrug-resistant S. agona carry numerous genes that might influence cellular physiology and metabolism

  • Prophages: Integrated viral genomes can encode regulators that affect bacterial gene expression

Antibiotic Resistance and Metabolic Adaptation:
The presence of multiple antibiotic resistance genes, as observed in multidrug-resistant S. agona isolates , may necessitate metabolic adaptations that influence respiratory chain components:

  • Energy burden of resistance: Maintaining resistance mechanisms requires energy, potentially affecting respiratory chain regulation

  • Compensatory mutations: As seen with suppressor mutations in other nuo subunits , strains may acquire compensatory changes to optimize energy metabolism

  • Stress response alterations: Different resistance profiles may trigger varying stress responses that affect nuoA expression

Environmental Adaptation:
Salmonella agona strains from different sources (e.g., food products, animal hosts, clinical isolates) may have adapted to specific niches:

  • Oxygen availability adaptation: Affecting reliance on aerobic respiration and thus nuoA function

  • Host-specific adaptations: Changes in metabolism to utilize available nutrients in specific hosts

  • Biofilm formation capacity: Potentially altering respiratory requirements and nuoA regulation

Understanding these strain-specific differences requires comparative genomic and transcriptomic analyses across diverse S. agona isolates, coupled with functional characterization of nuoA in different genetic backgrounds. Such studies would provide insights into how evolutionary pressures and horizontal gene transfer events shape the respiratory capabilities of this important pathogen.

What are the current knowledge gaps and future research directions for nuoA in Salmonella agona?

Despite our growing understanding of NADH-quinone oxidoreductase in Salmonella, several significant knowledge gaps remain regarding nuoA in Salmonella agona that warrant further investigation:

Structural and Functional Gaps:

  • The atomic-level structure of nuoA and its precise positioning within the NADH-quinone oxidoreductase complex in Salmonella agona remains unresolved

  • The specific functional contribution of nuoA to electron transfer, compared to other membrane subunits, is not fully characterized

  • The potential serovar-specific adaptations of nuoA in S. agona versus other Salmonella serovars are unexplored

Regulatory Gaps:

  • The transcriptional and post-transcriptional regulation of nuoA under different environmental conditions lacks comprehensive characterization

  • The influence of global regulators on nuoA expression in response to host environments remains poorly understood

  • Post-translational modifications that might affect nuoA function are largely unexplored

Pathogenesis-Related Gaps:

  • The direct contribution of nuoA to Salmonella agona virulence has not been systematically assessed

  • The role of nuoA in adaptation to different host environments and stress conditions requires further investigation

  • The impact of nuoA mutations on antimicrobial resistance mechanisms needs exploration

Future Research Directions:

  • Structural Biology Approaches:

    • Cryo-EM studies of the complete NADH-quinone oxidoreductase complex from S. agona

    • Comparative structural analyses across different Salmonella serovars

  • Systems Biology:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics) to understand nuoA in the context of cellular networks

    • Flux analysis to quantify electron flow through different respiratory pathways

  • Evolutionary Studies:

    • Comparative genomics across larger collections of S. agona isolates to track nuoA evolution

    • Analysis of selection pressures on nuoA in different environments

  • Translational Research:

    • Development of nuoA-targeted antimicrobials or inhibitors

    • Exploration of nuoA as a potential vaccine target

    • Investigation of nuoA as a biomarker for specific Salmonella agona lineages

  • Technological Developments:

    • New tools for real-time monitoring of NADH-quinone oxidoreductase activity in living cells

    • Improved expression systems for membrane proteins to facilitate detailed biochemical studies

Addressing these knowledge gaps and pursuing these research directions will significantly enhance our understanding of nuoA in Salmonella agona and potentially lead to new strategies for controlling this important pathogen.

How can collaborative research approaches advance our understanding of NADH-quinone oxidoreductase in Salmonella pathogenesis?

Collaborative research approaches are essential for advancing our understanding of complex biological systems like NADH-quinone oxidoreductase in Salmonella pathogenesis. Multi-disciplinary collaboration can accelerate progress in several ways:

Integrating Diverse Expertise:

  • Structural biologists and biochemists: Providing detailed molecular insights into nuoA structure and function

  • Microbiologists and molecular geneticists: Developing genetic tools and bacterial strains

  • Immunologists and infection biologists: Characterizing host-pathogen interactions

  • Computational biologists and bioinformaticians: Analyzing complex datasets and developing predictive models

  • Clinical researchers: Connecting laboratory findings to real-world infections

Technology Integration:
Collaborative approaches enable the application of cutting-edge technologies from different fields:

  • Advanced imaging: Super-resolution microscopy, cryo-EM, and correlative light and electron microscopy

  • High-throughput screening: Drug discovery and functional genomics

  • Single-cell technologies: Understanding heterogeneity in bacterial populations

  • In silico modeling: Predicting protein interactions and metabolic networks

Consortium-Based Approaches:
Large-scale collaborative projects focused on Salmonella research could:

  • Create standardized strain collections and methodologies

  • Develop comprehensive databases integrating genomic, transcriptomic, and functional data

  • Establish shared resources for specialized equipment and expertise

  • Coordinate multi-center clinical studies to link basic science findings to human infections

Translational Benefits:
Collaborative research can bridge the gap between basic science and applications:

  • Academic-industry partnerships for antimicrobial development

  • Collaborations between research institutes and public health agencies for surveillance

  • Integration of basic research findings into diagnostic and treatment guidelines

Examples of Successful Collaborative Models:
Studies on Salmonella outbreaks have already demonstrated the value of collaboration between public health laboratories, academic institutions, and regulatory agencies. For instance, the retrospective analysis of S. Agona outbreaks combined epidemiological data with advanced genomic approaches to track strain evolution over time . Similarly, the characterization of multidrug-resistant isolates has involved expertise in genomics, plasmid biology, and antimicrobial resistance mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.