Recombinant Salmonella agona NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Structure and Biochemical Characteristics

NuoK belongs to the hydrophilic domain of NDH-1, which facilitates electron transfer from NADH to quinones. Key features include:

  • Recombinant Production: Expressed in E. coli with an N-terminal His-tag for purification (e.g., 1–100 amino acids from Salmonella arizonae homologs) .

  • Domain Architecture: NuoK interacts with other subunits (e.g., NuoG, NuoM, NuoN) to form the functional NDH-1 complex, enabling proton translocation and electron transport .

  • Quinone Binding: While NuoK itself does not directly bind quinones, mutations in adjacent subunits (e.g., NuoM, NuoN) alter electron flow efficiency to alternative quinones like demethylmenaquinone (DMK) .

Functional Role in Salmonella Respiration

NuoK is essential for aerobic and anaerobic respiration. Key findings from suppressor mutation studies in Salmonella highlight its importance:

PhenotypeMechanistic InsightSource
Rescued MotilitySuppressor mutations in nuoG (Q297K), nuoM (A254S), or nuoN (A444E) restore electron flow to DMK in ubiquinone-deficient mutants.
Quinone Pool CompositionubiA deletion mutants accumulate DMK and menaquinone instead of ubiquinone.
Enzyme ActivitydNADH-oxidase activity in suppressor mutants reaches 23–66% of wild-type levels.

Research Applications and Implications

Recombinant nuoK is critical for studying:

  • Electron Transport Flexibility: Mutations in NDH-1 subunits enable Salmonella to utilize alternative quinones under stress, highlighting adaptive respiratory strategies .

  • Proton Translocation: Structural studies on NuoK's interactions with membrane-embedded subunits (e.g., NuoM, NuoN) elucidate proton pumping mechanisms .

  • Antibiotic Target Development: Suppressor mutations reveal vulnerabilities in NDH-1, which could inform drug design targeting bacterial respiration .

Key Research Findings

  • Suppressor Mutations:

    • nuoG(Q297K), nuoM(A254S), and nuoN(A444E) mutations compensate for ubiquinone deficiency by enhancing DMK utilization .

    • NDH-1 levels increase in ubiA deletion mutants, suggesting a regulatory response to quinone scarcity .

  • Enzyme Activity:

    • dNADH-K₃Fe(CN)₆ reductase activity (measuring NADH dehydrogenase domain function) reaches 40% of wild-type in ΔnuoG mutants .

Challenges and Future Directions

  • Species-Specific Data Gaps: Most studies focus on Salmonella subspecies like arizonae and paratyphi C. Further work is needed to validate findings in S. agona.

  • Structural Insights: High-resolution crystallography of NuoK in complex with other subunits could clarify its role in electron transfer.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; SeAg_B2458; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Salmonella agona (strain SL483)
Target Names
nuoK
Target Protein Sequence
MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), effectively conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase in Salmonella agona respiratory chain?

NADH-quinone oxidoreductase (NDH-1) in Salmonella agona serves as the primary entry point for electrons into the respiratory chain. This enzyme catalyzes the transfer of electrons from NADH to quinones (ubiquinone, menaquinone, or demethylmenaquinone) while simultaneously pumping protons across the membrane to generate the proton motive force needed for ATP synthesis. In Salmonella, ubiquinone typically functions as the primary mobile electron-carrier in aerobic respiration, while demethylmenaquinone and menaquinone serve as alternative electron-carriers during anaerobic respiration . The enzyme consists of multiple subunits organized into a hydrophilic domain (involved in electron transfer) and a hydrophobic membrane-embedded domain (involved in proton translocation) where the nuoK subunit is located. This complex is essential for bacterial energy metabolism, particularly when adapting to different environmental conditions.

What are the recommended methods for cloning the nuoK gene from Salmonella agona?

For cloning the nuoK gene from Salmonella agona, a methodical approach based on established molecular techniques is recommended:

  • Genomic DNA Extraction: Extract high-quality genomic DNA using a validated protocol such as the Maxwell 16 LEV Blood DNA Kit or similar commercial kits with appropriate enzymatic pretreatment (lysozyme, Proteinase K, and RNase A) as described for Salmonella Agona isolates .

  • PCR Amplification: Design primers specific to the nuoK gene with flanking regions (typically 20-25bp) and appropriate restriction sites for subsequent cloning. Include a 5' start codon and 3' stop codon if expressing the full protein. Consider codon optimization if the expression system differs from Salmonella.

  • Cloning Strategy: For initial characterization, clone the PCR product into a high-copy vector like pUC or pBluescript. For expression studies, use vectors with inducible promoters (like pET series for E. coli expression) that include appropriate fusion tags (His, GST, etc.) for purification and detection.

  • Verification: Confirm successful cloning by restriction digestion and Sanger sequencing using both vector-specific and internal primers to ensure the entire nuoK sequence is error-free.

The choice of expression system should be based on your downstream applications. For structural studies requiring high yields of membrane protein, specialized E. coli strains designed for membrane protein expression (like C41(DE3) or C43(DE3)) are recommended to avoid toxicity issues commonly associated with membrane protein overexpression.

How can researchers confirm the correct folding and membrane integration of recombinant nuoK?

Confirming proper folding and membrane integration of recombinant nuoK requires multiple complementary approaches:

  • Subcellular Fractionation: Separate bacterial cell fractions (cytoplasmic, periplasmic, and membrane) through differential centrifugation and detergent extraction. Analyze each fraction by Western blotting using antibodies against nuoK or its fusion tag to confirm localization to the membrane fraction.

  • Protease Accessibility Assay: Treat intact membrane vesicles containing recombinant nuoK with proteases (e.g., trypsin). Properly integrated membrane proteins will have protease-resistant domains (those embedded in the membrane) and protease-accessible domains (those exposed to the solvent). Compare digestion patterns from intact vesicles versus detergent-solubilized preparations.

  • Functional Complementation: Express recombinant nuoK in a nuoK-deficient strain and measure restoration of NADH:quinone oxidoreductase activity using methods similar to those described for assessing electron transfer from NADH to demethylmenaquinone or menaquinone . Complementation of growth defects in respiratory-deficient strains provides strong evidence for proper folding and integration.

  • Circular Dichroism (CD) Spectroscopy: After purification in appropriate detergents, analyze the secondary structure content using CD spectroscopy to confirm the expected alpha-helical content typical of membrane-embedded subunits of NADH:quinone oxidoreductase.

These methods collectively provide robust evidence for proper membrane integration and folding of the recombinant nuoK protein.

What are the challenges in studying sequence variations of nuoK across different Salmonella agona strains?

Studying sequence variations of nuoK across different Salmonella agona strains presents several methodological challenges:

  • Limited Genomic Coverage: While genomic surveillance of Salmonella has improved, many historical isolates lack whole genome sequencing data. For example, France lacked genomic surveillance pre-2017, making it difficult to track evolutionary changes in genes like nuoK over extended periods .

  • Balanced Representation: Ensuring a representative sampling across different epidemiological contexts is challenging. The search results indicate that S. agona isolates show clonal expansion at the HC5 level during certain years (2017-2018), which could lead to sampling bias if not accounted for in evolutionary analyses .

  • Resolution of Typing Methods: Different typing methods offer variable resolution for detecting mutations. While species-level core genome multilocus sequence typing (cgMLST) provides standardization advantages, serovar-specific cgMLST or SNP genotyping offers higher resolution that may be necessary to detect subtle variations in highly conserved genes like nuoK .

  • Phenotype-Genotype Correlation: Correlating sequence variations with functional consequences requires complex biochemical assays. As seen with nuoG, nuoM, and nuoN mutations that improved electron flow in ubiquinone-biosynthesis mutants , functional characterization of nuoK variants would require specialized enzymatic assays to measure electron transfer and proton translocation.

To address these challenges, researchers should employ a combination of phylogenomic approaches, including:

  • Whole genome sequencing with both short-read (for SNP detection) and long-read technologies (for structural variations)

  • Comparative analysis using both species-level and serovar-specific cgMLST schemes

  • Functional characterization of identified variants through complementation studies

What expression systems are most effective for producing recombinant Salmonella agona nuoK protein?

For expressing recombinant Salmonella agona nuoK protein, several expression systems can be employed, each with specific advantages for membrane protein production:

  • E. coli-based Systems:

    • C41(DE3)/C43(DE3) strains: Derived from BL21(DE3), these strains contain mutations that prevent membrane protein toxicity and are thus preferred for membrane subunits like nuoK.

    • pBAD vector system: The arabinose-inducible promoter allows for fine-tuning of expression levels, which is critical for membrane proteins that can be toxic when overexpressed.

    • Fusion partners: Using fusion tags like MBP (maltose-binding protein) can enhance solubility and facilitate purification.

  • Cell-free Expression Systems:

    • Particularly valuable for toxic membrane proteins, these systems allow direct synthesis into supplied liposomes or nanodiscs.

    • E. coli extract-based cell-free systems supplemented with detergents or lipids can produce functional membrane proteins without cellular toxicity constraints.

  • Homologous Expression:

    • Expression in attenuated Salmonella strains may provide the most native-like environment for proper folding and assembly of nuoK into the NADH:quinone oxidoreductase complex.

Expression should be optimized using a factorial approach testing different temperatures (typically lower temperatures like 18-25°C improve membrane protein folding), induction conditions, and media formulations. For functional studies requiring the assembled complex, co-expression of multiple nuo operon subunits may be necessary, as isolated nuoK might not fold properly without its interacting partners.

What detergents and solubilization methods are recommended for purifying membrane-embedded nuoK?

Purifying membrane-embedded nuoK requires careful selection of detergents and optimization of solubilization conditions:

Recommended Detergents (in order of increasing harshness):

DetergentCMC (mM)Micelle Size (kDa)Applications
DDM (n-Dodecyl β-D-maltoside)0.1750-70Initial extraction, mild
LMNG (Lauryl maltose neopentyl glycol)0.01100Enhanced stability, cryo-EM
Digitonin0.570-90Preserves protein-lipid interactions
CHAPS8-106Intermediate harshness
Triton X-1000.2-0.2590Effective solubilization

Solubilization Protocol:

  • Membrane Preparation: Isolate membrane fractions through differential centrifugation after cell lysis by sonication or French press.

  • Detergent Screening: Perform small-scale solubilization tests with different detergents (1-2% w/v) at various protein:detergent ratios.

  • Optimization Steps:

    • Control temperature (typically 4°C to minimize degradation)

    • Adjust pH based on protein theoretical pI

    • Include stabilizing agents (glycerol 10-20%, specific lipids)

    • Add protease inhibitors to prevent degradation

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged nuoK

    • Size exclusion chromatography to remove aggregates and excess detergent

    • Consider detergent exchange during purification if initial extraction detergent is not optimal for downstream applications

  • Stability Assessment:

    • Monitor protein stability using techniques like differential scanning fluorimetry with various detergent and buffer conditions

For functional studies, consider reconstitution into proteoliposomes or nanodiscs, which better mimic the native membrane environment and can enhance protein stability compared to detergent micelles.

How can researchers assess the purity and integrity of isolated recombinant nuoK protein?

Assessing the purity and integrity of isolated recombinant nuoK protein requires a multi-technique approach:

  • SDS-PAGE Analysis:

    • Regular and special protocols for membrane proteins (including sample preparation at room temperature rather than boiling)

    • Silver staining for higher sensitivity to detect minor contaminants

    • Western blotting with antibodies against nuoK or its fusion tag

  • Mass Spectrometry:

    • Peptide mass fingerprinting after tryptic digestion to confirm protein identity

    • Intact protein mass spectrometry to verify full-length protein and potential post-translational modifications

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to assess protein folding and dynamics

  • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS):

    • Determines the molecular weight of the protein-detergent complex

    • Assesses homogeneity and oligomeric state of the purified protein

  • Functional Assays:

    • NADH oxidation activity measurements similar to the enzyme assays described for measuring electron transfer from NADH to quinones

    • Proton translocation assays using pH-sensitive fluorescent dyes in reconstituted proteoliposomes

  • Thermal Stability Assays:

    • Differential scanning fluorimetry to assess protein stability in different buffer and detergent conditions

    • Circular dichroism thermal melts to monitor unfolding transitions

For membrane proteins like nuoK, it's particularly important to assess not just purity but also native-like folding, as improper folding may not be evident from SDS-PAGE alone. The presence of expected secondary structure content (predominantly alpha-helical for nuoK) should be confirmed using circular dichroism spectroscopy.

What methods can be used to study electron transfer activity of nuoK within the NADH-quinone oxidoreductase complex?

  • Spectrophotometric NADH Oxidation Assays:

    • Monitor NADH oxidation at 340 nm in the presence of various quinone acceptors (ubiquinone, menaquinone, or demethylmenaquinone)

    • Compare wild-type activity with nuoK mutants or reconstituted systems containing recombinant nuoK

    • Similar approaches were used to measure electron transfer from NADH to demethylmenaquinone or menaquinone in ubiquinone-biosynthesis mutant strains

  • Oxygen Consumption Measurements:

    • Use Clark-type oxygen electrodes to measure respiration rates in intact cells or membrane vesicles

    • Apply specific inhibitors (such as piericidin A or rotenone) to distinguish Complex I activity from other respiratory chain components

  • Artificial Electron Acceptor Assays:

    • Employ artificial electron acceptors like ferricyanide or 2,6-dichlorophenolindophenol (DCIP) that bypass parts of the electron transport chain to isolate specific segments of the electron transfer pathway

  • Proton Translocation Measurements:

    • Use pH-sensitive fluorescent probes (ACMA, pyranine) to monitor proton translocation across membranes

    • Measure the H+/e- ratio to assess coupling efficiency between electron transfer and proton pumping

  • Site-Directed Mutagenesis Studies:

    • Introduce specific mutations in nuoK and assess their impact on both electron transfer and proton translocation

    • Focus on residues predicted to be involved in quinone binding or channel formation

  • Quinone Binding Studies:

    • Use fluorescent or radioactively labeled quinone analogs to study binding kinetics

    • Perform competition assays with different quinone types to assess specificity

These methods can help determine how nuoK contributes to the complex's ability to utilize different quinones, which is particularly relevant given the findings that S. enterica can adapt to utilize alternative electron carriers like demethylmenaquinone and menaquinone when ubiquinone biosynthesis is disrupted .

How can researchers investigate the role of nuoK in proton translocation across the bacterial membrane?

Investigating nuoK's role in proton translocation across the bacterial membrane requires specialized techniques that focus on this specific aspect of NADH-quinone oxidoreductase function:

  • Proteoliposome Reconstitution Systems:

    • Purify the complex or subcomplex containing nuoK and reconstitute into liposomes

    • Create a defined orientation (right-side-out or inside-out) to control direction of proton pumping

    • Compare systems with wild-type nuoK versus mutant variants

  • pH-Sensitive Fluorescent Probes:

    • Encapsulate pH-sensitive fluorophores (ACMA, pyranine, SNARF) in proteoliposomes

    • Monitor fluorescence changes upon energization with NADH to detect proton translocation

    • Use calibration curves to quantify proton movement

  • Patch-Clamp Electrophysiology:

    • For higher resolution analysis, apply patch-clamp techniques to bacterial spheroplasts or proteoliposomes

    • Measure ionic currents associated with proton translocation through the complex

  • Potentiometric Dyes:

    • Use membrane potential-sensitive dyes (DiSC3(5), Oxonol VI) to monitor the electrical component of the proton motive force

    • Discriminate between electroneutral and electrogenic processes

  • Site-Directed Mutagenesis Targeting Proton Pathway:

    • Identify conserved charged residues in nuoK that might participate in proton translocation

    • Create systematic mutations (particularly of charged or highly conserved residues) and assess their impact on proton pumping without affecting electron transfer

    • Similar approaches revealed the functional importance of mutations in other membrane subunits like nuoM(A254S) and nuoN(A444E)

  • Deuterium Kinetic Isotope Effect Studies:

    • Compare proton translocation rates in H2O versus D2O to identify rate-limiting steps in the proton transfer pathway

  • Bacterial Growth Analysis Under Different Respiratory Conditions:

    • Compare growth of wild-type versus nuoK mutants under conditions that specifically require proton pumping for energy conservation

    • Use media with different carbon sources such as L-malate, which was used to assess the function of suppressor mutants in ubiquinone biosynthesis-deficient strains

These techniques collectively can provide insights into how nuoK contributes to the proton translocation function of the complex and how this function might adapt when the quinone pool composition changes, as observed in ubiquinone biosynthesis mutants .

What experimental approaches can determine if nuoK mutations affect quinone binding specificity?

Determining whether nuoK mutations affect quinone binding specificity requires a combination of biochemical, biophysical, and computational approaches:

  • Enzyme Kinetics with Different Quinones:

    • Perform steady-state kinetics measuring NADH:quinone oxidoreductase activity using purified enzyme (wild-type vs. mutant)

    • Compare kinetic parameters (Km, Vmax, kcat/Km) with different quinone substrates (ubiquinone, menaquinone, demethylmenaquinone)

    • Calculate specificity constants for each quinone to quantify preference shifts

  • Direct Binding Assays:

    • Utilize isothermal titration calorimetry (ITC) to measure binding thermodynamics

    • Employ surface plasmon resonance (SPR) or microscale thermophoresis (MST) for binding kinetics

    • Use fluorescently labeled quinone analogs for fluorescence anisotropy measurements

  • Competition Assays:

    • Perform displacement studies with labeled and unlabeled quinones

    • Determine IC50 values for different quinones competing for the same binding site

  • Structural Biology Approaches:

    • Conduct X-ray crystallography or cryo-EM analysis of the complex with bound quinones

    • Perform hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with altered solvent accessibility upon quinone binding

  • Computational Methods:

    • Use molecular docking to predict binding modes of different quinones

    • Perform molecular dynamics simulations to observe how mutations affect quinone binding pocket dynamics

  • Photolabeling Studies:

    • Employ photoactivatable quinone analogs that covalently attach to nearby residues upon UV exposure

    • Identify labeled residues by mass spectrometry to map the binding site

  • Functional Complementation Tests:

    • Express nuoK variants in strains with different quinone biosynthesis pathways (e.g., ubiA or ubiE deletion mutants that produce alternative quinones )

    • Assess growth restoration and respiratory activity under different conditions

  • In vivo Quinone Pool Analysis:

    • Analyze the composition of quinone pools in membranes using reversed-phase HPLC

    • Compare how nuoK mutations affect the distribution and utilization of different quinones

These approaches would help determine whether nuoK mutations can influence quinone preference, similar to how suppressor mutations in nuoG, nuoM, and nuoN improved electron flow activity in ubiquinone-deficient strains by enhancing their ability to utilize alternative quinones like demethylmenaquinone and menaquinone .

How does nuoK function contribute to Salmonella agona persistence in host environments?

The contribution of nuoK function to Salmonella agona persistence in host environments can be understood through several mechanisms:

  • Metabolic Adaptation to Quinone Availability:

    • Within host environments, Salmonella faces varying oxygen levels and nutrient limitations that affect quinone composition

    • The ability of NADH:quinone oxidoreductase (including nuoK) to utilize different quinones (ubiquinone, menaquinone, demethylmenaquinone) enables metabolic flexibility

    • This adaptability is crucial during the transition from acute to persistent infection, where bacteria must adjust to different host microenvironments

  • Energy Generation During Nutrient Limitation:

    • During persistent infection, Salmonella often faces nutrient-limited conditions

    • Efficient proton translocation through the membrane domain (where nuoK resides) is essential for maintaining the proton motive force and ATP synthesis under these conditions

    • Suppressor mutations in other membrane subunits (nuoM, nuoN) have shown improved electron flow activity under certain growth conditions , suggesting that optimal function of membrane subunits is crucial for adaptation

  • Contribution to Viable but Non-Culturable (VBNC) State:

    • S. agona can enter a VBNC state with approximately 1% of the population remaining metabolically active

    • Respiratory chain components, including nuoK, likely play a role in maintaining minimal metabolism during this state

    • This state has been linked to persistence both in food processing environments and potentially during human infection

  • Support for Biofilm Formation:

    • S. agona has been identified as a strong biofilm-forming serovar

    • Energy metabolism proteins, including respiratory chain components, are often differentially regulated during biofilm formation

    • Proper energy generation through NDH-1 (including nuoK) may support the metabolic transitions required for biofilm establishment

  • Adaptation to Host Immune Responses:

    • During persistent infection, Salmonella must adapt to oxidative and nitrosative stress from host immune cells

    • Respiratory chain flexibility, including the ability to use different quinones through NDH-1, contributes to this adaptation

    • Genomic analysis of S. agona has revealed increased SNP variation and genome rearrangements during persistent infection , which could affect respiratory components

These mechanisms collectively suggest that nuoK, as part of the NADH:quinone oxidoreductase complex, contributes to the metabolic adaptability required for S. agona to persist in diverse host environments, similar to strategies employed by S. Typhi during chronic carriage .

What experimental models are best suited to study the impact of nuoK mutations on Salmonella agona virulence?

Several experimental models can effectively assess the impact of nuoK mutations on Salmonella agona virulence, each with specific advantages for different aspects of pathogenesis:

  • Cell Culture Models:

    • Macrophage Infection Assays: Using RAW264.7 or primary macrophages to assess intracellular survival and replication

    • Epithelial Cell Invasion Assays: Using Caco-2 or HT-29 intestinal epithelial cells to measure invasion efficiency

    • Co-culture Systems: Combining epithelial and immune cells to model complex interactions

    • These systems allow precise measurement of bacterial energy metabolism genes' contribution to key virulence processes

  • Gallstone Biofilm Models:

    • In vitro cholesterol gallstone models to assess biofilm formation capacity

    • Particularly relevant given that S. agona has been isolated from gallbladder and is known to be a strong biofilm former

    • Allows comparison of wild-type and nuoK mutants in biofilm establishment and maintenance

  • Animal Infection Models:

    • Streptomycin-pretreated Mouse Model: For studying acute gastroenteritis

    • Chronic Carriage Mouse Model: For assessing long-term persistence

    • Gallstone Mouse Model: Combining gallstone formation with infection to study biofilm-related persistence

    • These models allow assessment of both acute virulence and chronic persistence capabilities

  • Ex vivo Organ Culture Systems:

    • Intestinal tissue explants to study interaction with host tissue in a more complex environment

    • Provides an intermediate between cell culture and animal models

  • Competitive Index Assays:

    • Co-infection with wild-type and nuoK mutant strains

    • Calculate competitive index to quantify relative fitness

    • Particularly valuable for subtle phenotypes that might be missed in single-strain infections

  • Stress Response Models:

    • Acid Tolerance Response Assays: To determine if nuoK affects survival during gastric passage

    • Oxidative Stress Resistance Tests: Using hydrogen peroxide or superoxide generators

    • Nutrient Limitation Assays: Testing growth in minimal media with various carbon sources, similar to how L-malate was used to assess suppressor mutants in ubiquinone-deficient strains

  • Genome-wide Approaches:

    • Transcriptomic Analysis: RNA-seq comparing gene expression between wild-type and nuoK mutants during infection

    • Metabolomic Profiling: Assessing metabolic changes resulting from nuoK mutation

    • These approaches can reveal compensatory mechanisms and broader impacts on bacterial physiology

When designing these experiments, it's important to consider that mutations affecting respiratory function may have pleiotropic effects on multiple virulence determinants. Therefore, a combination of these models is typically necessary to comprehensively assess the role of nuoK in S. agona pathogenesis and persistence.

How can researchers distinguish between direct effects of nuoK dysfunction and compensatory adaptations in pathogenicity studies?

Distinguishing between direct effects of nuoK dysfunction and compensatory adaptations in pathogenicity studies requires a multi-faceted approach combining genetic, biochemical, and systems biology techniques:

  • Temporal Analysis of Adaptation:

    • Time-course Experiments: Monitor phenotypic and genetic changes over time following introduction of nuoK mutations

    • Experimental Evolution: Passage nuoK mutants through selective conditions and sequence at intervals to identify compensatory mutations

    • This approach can reveal the sequence of adaptations, similar to how suppressor mutations were identified in ubiquinone biosynthesis mutant strains

  • Genetic Manipulation Strategies:

    • Clean Deletion and Complementation: Create markerless nuoK deletions and complement with wild-type or mutant alleles under native promoter control

    • Inducible Expression Systems: Use tightly controlled expression systems to modulate nuoK function acutely, before compensatory mechanisms engage

    • Double Mutant Analysis: Create mutations in nuoK and potential compensatory pathways to assess epistatic relationships

  • Multi-omics Integration:

    • Comparative Transcriptomics: RNA-seq analysis comparing acute vs. adapted nuoK mutants

    • Proteomics: Quantify protein abundance changes to identify upregulated pathways

    • Metabolomics: Assess metabolic profile shifts, particularly in energy metabolism intermediates

    • Fluxomics: Measure metabolic flux changes using isotope labeling

    • Integration of these datasets can reveal coordinated adaptive responses

  • Fitness Landscape Mapping:

    • Systematically introduce mutations to multiple components of the respiratory chain

    • Assess epistatic interactions that reveal compensatory relationships

    • This approach could identify relationships similar to those observed between ubiquinone biosynthesis and NADH:quinone oxidoreductase mutations

  • Suppressor Mutation Analysis:

    • Allow nuoK mutants to accumulate suppressor mutations naturally

    • Use whole genome sequencing to identify suppressor mutations, similar to the approach used to identify nuoG, nuoM, and nuoN mutations compensating for ubiquinone deficiency

    • Validate the compensatory nature through reconstruction of the suppressor mutations in clean genetic backgrounds

  • Quinone Pool Characterization:

    • Analyze the composition of quinone pools using reversed-phase HPLC

    • Assess whether nuoK mutation alters quinone biosynthesis as a compensatory mechanism

    • Compare with the shifts observed in ubiquinone biosynthesis mutants that showed altered menaquinone and demethylmenaquinone levels

  • Comparative Analysis Across Growth Conditions:

    • Analyze phenotypes under diverse conditions (varying oxygen, carbon sources, stress factors)

    • Direct effects of nuoK dysfunction should be consistent across conditions, while compensatory adaptations may be condition-specific

    • This approach can leverage the observation that suppressor mutations improved electron flow activity under certain growth conditions

By integrating these approaches, researchers can build a comprehensive picture of both the immediate consequences of nuoK dysfunction and the subsequent adaptive responses that might mask or modify these effects in pathogenicity studies.

How can structural studies of nuoK contribute to the design of selective inhibitors targeting bacterial respiratory chains?

Structural studies of nuoK can significantly advance the development of selective inhibitors targeting bacterial respiratory chains through several strategic approaches:

  • High-Resolution Structural Determination:

    • Use cryo-electron microscopy (cryo-EM) to resolve the structure of nuoK within the intact NADH:quinone oxidoreductase complex

    • Apply X-ray crystallography to nuoK alone or in subcomplexes when possible

    • Employ NMR spectroscopy for dynamic studies of smaller domains or peptides

    • These structures can reveal unique features of bacterial nuoK compared to mammalian homologs

  • Identification of Targetable Pockets:

    • Analyze the resolved structures to identify druggable pockets unique to bacterial nuoK

    • Focus on regions involved in:

      • Quinone binding sites

      • Subunit interfaces specific to bacterial complexes

      • Proton translocation channels

    • Compare with mammalian Complex I structure to identify bacterial-specific features

  • Structure-Based Virtual Screening:

    • Perform in silico docking of compound libraries against identified pockets

    • Apply molecular dynamics simulations to assess binding stability and induced-fit effects

    • Use fragment-based approaches to build inhibitors targeting specific interactions

  • Rational Design Based on Quinone Analogs:

    • Develop quinone-like molecules that specifically interact with the bacterial binding site

    • Exploit the differences in quinone specificity between mammalian and bacterial enzymes

    • Use insights from how different quinones (ubiquinone, menaquinone, demethylmenaquinone) interact with the complex

  • Targeting Conformational Changes:

    • Identify critical residues involved in conformational changes coupling electron transfer to proton pumping

    • Design inhibitors that lock the protein in non-productive conformations

    • Focus on the interface between nuoK and other membrane subunits like nuoM and nuoN, where suppressor mutations have been shown to alter function

  • Exploit Species-Specific Variations:

    • Compare nuoK sequences across different bacterial pathogens to identify conserved regions specific to bacteria

    • Design broad-spectrum antimicrobials targeting highly conserved bacterial features

    • Alternatively, develop narrow-spectrum agents targeting unique features of Salmonella agona nuoK

  • Validation Using Engineered Reporter Strains:

    • Create Salmonella strains with modified nuoK containing reporter tags or biosensors

    • Use these to screen compound libraries for molecules that specifically bind to or affect nuoK function

    • Validate hits with assays measuring effects on electron transfer and proton translocation

These approaches can leverage the structural and functional differences between bacterial and mammalian respiratory chain components to develop selective inhibitors with reduced host toxicity, potentially offering new therapeutic options for Salmonella infections, including persistent infections where S. agona has been shown to establish chronic carriage .

What experimental approaches can assess the potential of nuoK as a target for attenuating Salmonella agona for vaccine development?

Assessing nuoK as a potential target for attenuating Salmonella agona for vaccine development requires a systematic evaluation of attenuation, immunogenicity, and protective efficacy:

  • Rational Attenuation Strategy Development:

    • Site-directed Mutagenesis: Create a panel of nuoK mutants with varying degrees of functional impairment

    • Conditional Expression Systems: Develop strains with inducible or tissue-specific nuoK expression

    • Complementation Systems: Engineer strains where nuoK function can be restored in vitro but not in vivo

  • In Vitro Attenuation Assessment:

    • Growth Kinetics Analysis: Compare growth rates in rich and minimal media

    • Stress Survival Assays: Evaluate resistance to acid, oxidative stress, and nutrient limitation

    • Cell Culture Infection Models: Assess invasion, replication, and cytotoxicity in relevant cell lines

    • These assays can build upon observations that respiratory chain modifications affect growth in different media, as seen with suppressor mutants in ubiquinone biosynthesis-deficient strains

  • Animal Model Safety Evaluation:

    • Dose Escalation Studies: Determine maximum tolerated dose

    • Biodistribution Analysis: Track bacterial spread using reporter genes or recovery methods

    • Histopathological Assessment: Evaluate tissue damage at infection sites

    • Long-term Persistence Studies: Monitor clearance rates and assess potential for chronic infection

  • Immunological Profiling:

    • Antibody Response Characterization: Measure serum IgG, mucosal IgA, and antigen-specific responses

    • T-cell Response Analysis: Evaluate CD4+ and CD8+ T-cell activation and cytokine profiles

    • Dendritic Cell Activation: Assess antigen presentation and costimulatory molecule expression

    • Innate Immune Response: Measure inflammatory cytokine production and innate cell recruitment

  • Protection Efficacy Studies:

    • Homologous Challenge: Protection against the same Salmonella agona strain

    • Heterologous Challenge: Cross-protection against different Salmonella serovars

    • Different Challenge Routes: Oral, intraperitoneal, and intravenous challenges to assess route-specific protection

    • Long-term Protection: Evaluation of memory response durability

  • Comparative Analysis with Established Vaccine Strains:

    • Head-to-head Comparison: Evaluate nuoK-attenuated strains against established attenuated vaccines (e.g., aroA mutants)

    • Combined Attenuation Strategies: Test nuoK mutations in combination with other attenuating mutations

  • Genomic Stability Assessment:

    • Serial Passage Analysis: Evaluate genetic stability of the attenuated strain over multiple passages

    • In vivo Stability: Recover bacteria after animal infection to assess mutation reversion potential

    • Genome Sequencing: Monitor for compensatory mutations similar to the suppressor mutations observed in respiratory chain mutants

  • Vaccine Vector Potential:

    • Heterologous Antigen Expression: Evaluate ability to express and deliver antigens from other pathogens

    • Immune Response to Vectored Antigens: Assess humoral and cellular immunity to carried antigens

These approaches would provide comprehensive data on whether nuoK-attenuated S. agona strains could serve as effective live attenuated vaccines, balancing sufficient attenuation for safety with adequate persistence for immunogenicity, while considering the potential for genomic adaptation observed in S. agona during persistent infections .

How can systems biology approaches integrate nuoK function with global metabolic networks during Salmonella adaptation to host environments?

Systems biology approaches can effectively integrate nuoK function with global metabolic networks during Salmonella adaptation to host environments through several sophisticated methodologies:

  • Multi-omics Data Integration:

    • Comparative Transcriptomics: RNA-seq analysis of wild-type vs. nuoK mutants under host-relevant conditions

    • Proteomics: Quantitative analysis focusing on metabolic enzyme abundance changes

    • Metabolomics: Assessment of metabolite profiles with particular attention to redox balance indicators

    • Fluxomics: 13C metabolic flux analysis to quantify actual metabolic pathway activities

    • Integration of these datasets can reveal how nuoK dysfunction ripples through metabolic networks

  • Genome-scale Metabolic Modeling:

    • Develop constraint-based models (e.g., Flux Balance Analysis) of S. agona metabolism

    • Simulate the impact of nuoK mutations by constraining NADH oxidation and proton translocation parameters

    • Predict adaptive flux redistributions and essential compensatory reactions

    • Validate model predictions with experimental data from different quinone availability conditions, similar to observations in ubiquinone biosynthesis mutants

  • Regulatory Network Reconstruction:

    • Map transcription factor binding sites genome-wide using ChIP-seq

    • Identify regulators responding to altered redox status resulting from nuoK mutation

    • Construct hierarchical regulatory models connecting environmental sensing to metabolic adaptation

    • Compare with regulatory changes observed during persistent infections, where S. agona shows genome rearrangements and SNP variation

  • Host-Pathogen Interaction Analysis:

    • Dual RNA-seq to simultaneously capture host and bacterial transcriptional responses

    • Identify metabolic adaptations triggered by specific host microenvironments

    • Map metabolite exchange at the host-pathogen interface

  • Temporal Network Dynamics:

    • Time-course experiments tracking metabolic network adaptation after infection

    • Identify early vs. late adaptive responses

    • Link to temporal patterns observed during transition from acute to persistent infection

  • Comparative Systems Analysis Across Niches:

    • Compare metabolic network states across different host microenvironments:

      • Intestinal lumen

      • Within epithelial cells

      • Inside macrophages

      • Gallbladder (relevant as S. agona has been isolated from this site )

    • Identify condition-specific roles of nuoK and alternative respiratory pathways

  • In silico Perturbation Analysis:

    • Simulate network-wide effects of inhibiting nuoK function to varying degrees

    • Identify synthetic lethal targets that become essential when nuoK function is compromised

    • Predict potential mechanisms for the suppressor mutations observed in respiratory chain components

  • Evolutionary Systems Biology:

    • Trace genomic adaptation patterns in persistent infections

    • Link genetic variations to metabolic network rewiring

    • Integrate with persistence mechanisms such as biofilm formation and VBNC state adoption, which are known features of S. agona

Through these integrative approaches, researchers can understand how nuoK function (and dysfunction) propagates through the entire metabolic network, revealing adaptation mechanisms that enable Salmonella agona to persist in diverse host environments and potentially identifying new intervention targets for persistent infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.